KEGG   Trichoplax adhaerens: TRIADDRAFT_50163Help
Entry
TRIADDRAFT_50163  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
tad  Trichoplax adhaerens
Pathway
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:tad00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    TRIADDRAFT_50163
Enzymes [BR:tad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     TRIADDRAFT_50163
Protein kinases [BR:tad01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   TRIADDRAFT_50163
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 360 aa AA seqDB search
MAESAEIKTDYYRCELNKTVWEIPIHYQNLSPIGSGAYGQVCSAIDTRTNIEIAIKKLSR
PFESNTFGKRTFREMKLLMHMNQEQVISLLDTFTPTSGRSNFSDVYLVTPLMGADLNTVI
KCQPLSDDHVKFLVYQLMRGLKYIHSCRIIHRDLKPSNIAVNENCELKILDFGLARKASE
ELTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAEMLTSRPLFPGNDHIDQLTRILE
LVGCPSDEFIRKIQSEAARNYVAGMPKFPRKDFSTVFLGANPEAIDLLEKMLTLDSSQRI
DAIEALAHPYLAEYADPDDEPSGEPFDEGFEDLEISVEQWKDMVYKQIEEFKRINPSASP
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggcagaatcagcagagataaagacagactactatcgatgtgagttgaacaaaacagtc
tgggaaataccgatacattatcaaaatttaagcccaatcggttccggagcatacggacaa
gtctgttcagcgatagatacccgtaccaatattgaaatcgcgattaagaaattatcacgc
ccttttgaatcaaacaccttcggcaaaagaacattccgtgaaatgaaacttcttatgcac
atgaaccaggagcaggtcatcagtttactggatactttcacaccgactagtggacggtct
aattttagcgatgtatatttagttactccattaatgggagcagatttaaatacggtaatc
aaatgtcaaccgctatctgatgatcatgtcaaatttcttgtttatcaactaatgagagga
ttaaagtatatccattcctgcaggataatccatcgcgacttgaagccaagcaatatcgct
gtcaatgagaattgcgaattaaagattcttgattttggattggctcgtaaggcgtcagaa
gaattaactggttatgtcgctacaaggtggtatcgagctccagagattatgcttaattgg
atgcattacaatcaaactgttgacatttggtccgttggatgtattatggcggaaatgtta
acatctagaccactctttcctggaaatgatcatatcgatcaacttacacgtatcttggaa
ctggtgggatgtccttcggatgagtttattagaaaaattcagagtgaagccgctagaaat
tatgttgccggtatgcctaaatttccaagaaaagatttttcgacggtttttctgggagct
aatccggaagccatagatttacttgaaaaaatgttaactttggactcctcacaaagaatc
gatgccatcgaggccttagcgcatccttatctggctgaatatgcagacccagatgatgag
ccatccggagagccatttgatgaaggatttgaagacttggaaatctctgttgaacaatgg
aaagatatggtgtataaacaaattgaagaatttaaaagaataaacccttccgcaagtcct
taa

DBGET integrated database retrieval system