KEGG   Trichoplax adhaerens: TRIADDRAFT_50258Help
Entry
TRIADDRAFT_50258  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K09186  
histone-lysine N-methyltransferase MLL1 [EC:2.1.1.43]
Organism
tad  Trichoplax adhaerens
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    TRIADDRAFT_50258
Enzymes [BR:tad01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     TRIADDRAFT_50258
Transcription factors [BR:tad03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    TRIADDRAFT_50258
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 152 aa AA seqDB search
MAMRYRHLAATAKETVGVYRSDIHGRGLFCKRIIEAGEMIMEYAGTKIRSILTDKQEKYY
EGKGLGCYMFRIDRDEVIDATLSGNAARFINHSCDPNCYCKIVPIDNIKKIIIFALRRIY
PGEELTYDYNFAKEDIKLPCNCSSKKCRKFLN
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggctatgagatatcgtcatttagccgcaactgcgaaagaaactgtaggcgtttataga
tcagatatccacggacggggattgttttgtaaaaggattattgaagccggagaaatgatt
atggaatatgctggtactaaaattcgatcaattttaaccgataagcaggaaaagtattac
gaaggcaaaggtttaggttgttacatgtttaggatcgatcgtgatgaggtcattgatgcc
actcttagtggcaatgcagctagatttattaatcattcctgtgatcctaattgttattgc
aaaattgtacctattgacaatattaagaagatcataatctttgctttacgaagaatctat
cctggagaagaactgacatacgattataactttgcgaaagaagatattaaattaccgtgt
aactgtagttcaaagaaatgtcgaaagtttttgaattaa

DBGET integrated database retrieval system