KEGG   Trichoplax adhaerens: TRIADDRAFT_50258Help
Entry
TRIADDRAFT_50258  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K09186  
histone-lysine N-methyltransferase MLL1 [EC:2.1.1.43]
Organism
tad  Trichoplax adhaerens
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:tad00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 152 aa AA seqDB search
MAMRYRHLAATAKETVGVYRSDIHGRGLFCKRIIEAGEMIMEYAGTKIRSILTDKQEKYY
EGKGLGCYMFRIDRDEVIDATLSGNAARFINHSCDPNCYCKIVPIDNIKKIIIFALRRIY
PGEELTYDYNFAKEDIKLPCNCSSKKCRKFLN
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggctatgagatatcgtcatttagccgcaactgcgaaagaaactgtaggcgtttataga
tcagatatccacggacggggattgttttgtaaaaggattattgaagccggagaaatgatt
atggaatatgctggtactaaaattcgatcaattttaaccgataagcaggaaaagtattac
gaaggcaaaggtttaggttgttacatgtttaggatcgatcgtgatgaggtcattgatgcc
actcttagtggcaatgcagctagatttattaatcattcctgtgatcctaattgttattgc
aaaattgtacctattgacaatattaagaagatcataatctttgctttacgaagaatctat
cctggagaagaactgacatacgattataactttgcgaaagaagatattaaattaccgtgt
aactgtagttcaaagaaatgtcgaaagtttttgaattaa

DBGET integrated database retrieval system