KEGG   Trichoplax adhaerens: TRIADDRAFT_50293Help
Entry
TRIADDRAFT_50293  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
tad  Trichoplax adhaerens
Brite
Enzymes [BR:tad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     TRIADDRAFT_50293
Peptidases [BR:tad01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TRIADDRAFT_50293
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 327 aa AA seqDB search
MGSNSSQLEKEIGTELPANEHYFGLVNFGNTCYCNSVLQALYFCRPFREQVLMYKSNNKK
DSLLACLADLFKNISSQRRKIGVIAPKKFIAKLRKENDLFDNYMQQDAHEFLNYLLNTIA
DILQAATWVHEIFEGILVNETRCLCCESVSCKDESFLDLSVDVEENTSITSCLKGFSSTE
TLRSDQKYYCEQCCGKQEAEKRMRVKKLPKTLALHLKRFKYVEDLHRYTKLSYRVVFPLE
IKLFNMSNDATNPDQMYDLFAVVVHCGSGPNRGHYISIVKSHGFWLLFDDDAVEKIEPNA
MEDFYGLASETYKSSAAGYILFYQARE
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgggttctaactcatcgcaattagaaaaggaaattgggacagaattacccgctaatgag
cactactttggactggtcaattttggcaatacttgttattgcaactctgtcttgcaagcg
ttatacttctgtcgcccttttcgcgaacaagtgttgatgtacaaatccaataacaagaaa
gattctctattagcgtgcttggccgacttgttcaaaaatatctcatctcaaaggcgtaaa
attggtgttatagctcctaagaaatttatagcaaagctacgaaaagagaacgatttattt
gacaattacatgcaacaagatgctcacgaatttctaaactaccttctaaataccattgct
gatatattacaagccgcaacctgggttcatgaaatatttgagggaatcctagtaaatgaa
acgagatgtttgtgctgtgaaagcgtgagttgtaaggatgaatcatttcttgacttgtcg
gtagatgtggaagaaaatacatctataactagttgtttgaagggtttctcttcaacagaa
acacttcgtagtgatcaaaagtactattgcgaacaatgttgtggtaaacaagaagcagaa
aaacgaatgagagtgaagaagttgccaaagacgttggctcttcatctaaaacgcttcaaa
tatgttgaggatcttcatcgttacaccaaattatcttatcgagttgtatttcctcttgaa
ataaagctatttaatatgtccaacgatgccactaaccctgatcaaatgtacgatctattt
gctgttgtcgtacactgtggaagcggtccgaatcgaggacattatattagcattgtaaaa
agtcatggattttggttactttttgatgacgatgctgtcgagaaaatagaacctaatgca
atggaagatttctatggattagcttcggaaacctataaatcttctgcagcagggtacatt
ttattttatcaagcccgggagtaa

DBGET integrated database retrieval system