KEGG   Trichoplax adhaerens: TRIADDRAFT_50304Help
Entry
TRIADDRAFT_50304  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K00940  
nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
tad  Trichoplax adhaerens
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Module
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:tad00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:tad00240]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 200 aa AA seqDB search
MTSDSYQCTLAIIKPNAVRKEDEIVELLEKQGFCVLQRRCVRLTSEQASEFYTEHYGKMF
FPALVTFMSSGPIVAYILAKNNAIEDWRNSMGPTNSMNARIAAPESLRAKYGIDEMRNGF
HGSDGPLTAEREIRFFFPDFISHPVPDGQTATDYLQRRINPTLLKGLTELCKKKPDDAIL
WLANWLIENNPNKPKIEEPY
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgactagtgacagttatcagtgtaccctcgctattattaagcccaatgcagttaggaaa
gaagatgagatagtagaattattggaaaagcaaggattttgtgtacttcaaagacgctgt
gtccgactcacttcagaacaggccagtgaattctatacagagcactatgggaaaatgttc
tttccagcattggttacatttatgagtagtgggccaattgtagcttatatcttggctaag
aataatgcaattgaggattggagaaattccatgggacctacaaactcgatgaatgctcga
attgcagctcctgaaagtctacgtgcaaagtatgggattgatgagatgagaaacggcttc
catggtagtgatggtccattaactgctgagagagaaattcgatttttcttcccagatttc
atatcccatccggtaccagatggtcaaacagctacagactacttacaaaggagaatcaat
ccaactctcttgaaaggactaacagaattatgtaagaaaaagccagatgatgcaatttta
tggcttgctaactggttaatcgaaaataaccctaataagccgaaaatagaggagccttac
tag

DBGET integrated database retrieval system