KEGG   Trichoplax adhaerens: TRIADDRAFT_50520Help
Entry
TRIADDRAFT_50520  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
tad  Trichoplax adhaerens
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 310 aa AA seqDB search
MSTEIEPHILKKYDIRKRLGKGAYGIVWKAIDRKTNEIVAVKKIFDAFRNQTDAQRTFRE
IFFLQEFSGLDNIIKLINVIKAENDKDIYLVFEYMDTDLHNVIKKGNILKDVHKRYIMYQ
ILRAIKYMHSGNVIHRDLKPSNILLDSECFVKVADFGLARSLKRLTEEVANPNLTDYVAT
RWYRAPEILLSSQRYTFGVDMWSIGCILGEILIGKALFPGTSTLNQVEKIVQVIGHPRSE
DIQDLESNYAASLLHQIKTYPSTSLGGLCAGVPDDAMDLLKKLLHFNPKKRLTAEQALKH
PYIRRQITFI
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacagaaattgaacctcatatcctgaaaaagtacgacattagaaagcgcctagga
aaaggggcctatggtattgtatggaaagctatcgataggaaaaccaatgaaatagtagca
gtaaagaagattttcgacgcttttcgaaatcaaacggacgctcaaagaacatttcgtgaa
atattctttttacaggaatttagtgggctagataatatcatcaaattaattaacgtgatc
aaagctgaaaatgataaagatatctatttagtttttgaatatatggataccgatctacac
aatgtaattaagaaaggcaatatcttgaaggatgttcataagagatacataatgtatcag
atattaagagctatcaaatacatgcattccggaaacgttatccatcgtgatttaaagccc
agcaatattctcttggattcggaatgttttgtcaaggttgcagattttggtttagcaaga
tcgctcaaaagactaaccgaagaagtagcaaaccctaatttaactgattatgtagcaaca
agatggtatcgtgcacctgaaattttactatcatcacaaaggtatacttttggagtagat
atgtggtctattgggtgcatattaggagaaatattaataggtaaagcactctttccagga
acttcaactctaaaccaggtagaaaaaattgttcaagttattggacatccaaggagtgaa
gatatccaagatctggaatctaattacgctgcatccttattacatcaaattaagacatat
ccatcaacgtccctaggaggtttatgtgcaggtgtacctgatgatgcgatggacttatta
aagaagttgctccattttaatcccaagaaacgtttaactgctgaacaagcgctaaaacat
ccatatatcagaaggcaaattacatttatatag

DBGET integrated database retrieval system