KEGG   Trichoplax adhaerens: TRIADDRAFT_50528Help
Entry
TRIADDRAFT_50528  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
tad  Trichoplax adhaerens
Brite
Enzymes [BR:tad01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TRIADDRAFT_50528
Transfer RNA biogenesis [BR:tad03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    TRIADDRAFT_50528
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 515 aa AA seqDB search
MVLTIQDIIKQLIQAHDEGRDVNLNKIKSITSSKYGLPSQPRLVDIVAGVPRNYRKVLVP
KLKAKPVRTASGIAVVAVMCKPHRCPHISMTGNICVYCPGGPDSDFEYSTQSYTGYEPTS
MRAIRARYNPYLQVKHRTEQLRQLGHNVDKVEFIVMGGTFMALDEEYRDYFIRNLHDALS
GHTSNNVEEAVKYSEHSKTKCIGITIETRPDYCLKKHLSSMLNYGCTRLEIGVQSVYEDV
ARDTNRGHTVRAVCESFQQAKDAGFKVVAHMMPDLPNVDIERDIQGFTEFFENPAFRADG
LKIYPTLVIRGTGLYELWKTGRYRSYPPDVLIDLVARILALVPPWTRVYRVQRDIPMPLV
SSGVEHGNLRELALARMKDLGTECRDVRTREVGIQELHQKVKPYEVELIRRDYYANGGWE
TFLSYEDTFRSELKGGCSIVRELHLYGSVVPVSARDPTKFQHQGFGMLLMEEAERIALEE
HGSNKMSVISGVGTRNYYRKLGYELDGPYMSKSLR
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggtcttaacaatacaagatataatcaaacaattaattcaagctcatgacgaaggtcga
gatgttaacctcaataaaattaaaagtataacttcaagtaaatatggactaccatctcaa
ccacgtttggtagatatcgtagctggtgtaccacgaaattatagaaaggttcttgttccg
aaattgaaagcaaagcctgtccgaactgcatctggaatagctgttgtagctgtaatgtgc
aagcctcatcgctgtcctcacatttcaatgactggtaacatttgtgtttattgccctggt
ggacccgattctgactttgaatactcaactcagtcttatactggttatgagccaacttcc
atgagagcaattagagcacggtataatccttacttgcaagttaaacatcgaacagaacag
ttacggcagcttggtcacaatgtcgataaggttgaattcatagtgatgggtggaacattt
atggctttggatgaagaatatcgggattactttattcgcaacttacacgacgctctttct
ggtcatacaagtaataatgtagaagaagcagtaaaatactcggaacatagtaaaacaaaa
tgtatcggtattactatcgagacccgccctgattactgcctaaagaagcacttaagttct
atgctcaattatggatgtaccagattagaaattggagttcaaagcgtatatgaagacgtg
gcaagggacacaaatagagggcataccgtcagggcagtctgtgaatcttttcaacaagct
aaagacgctggttttaaggttgttgctcatatgatgccagatttgccgaatgtcgatata
gaacgtgatatacaaggtttcacggaatttttcgagaatcctgcatttcgagcagatggg
ctaaagatttatccaacactagtcataagaggaacaggactatatgaactatggaagact
ggaagatatagaagctatccccctgatgtattaatagatcttgtggctagaatcttagct
ctagtaccgccttggacgcgagtgtacagagttcaaagggatattcctatgccattagta
agctctggtgtcgagcacggaaacttgagagagttagcactagctaggatgaaagacctt
ggtactgagtgccgcgatgtacgtacgagggaagtcggaattcaagaattacatcaaaaa
gtcaagccttatgaggtggaactcattcgtcgtgattactacgccaacggaggctgggaa
actttcttatcttacgaagataccttcaggagtgaactgaaagggggatgttctatagtt
agagaactacatttatatggaagtgtagtgcctgtcagtgcacgggacccaacgaaattt
caacaccaaggttttggaatgctactaatggaggaagcagaacggatagcattggaggaa
cacggatccaataaaatgtctgttatatctggagttggcactagaaattattatagaaaa
cttggctacgaattagatggtccatacatgtcaaaaagcctaagatag

DBGET integrated database retrieval system