KEGG   Trichoplax adhaerens: TRIADDRAFT_50632Help
Entry
TRIADDRAFT_50632  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tad  Trichoplax adhaerens
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TRIADDRAFT_50632
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TRIADDRAFT_50632
   00020 Citrate cycle (TCA cycle)
    TRIADDRAFT_50632
   00620 Pyruvate metabolism
    TRIADDRAFT_50632
Enzymes [BR:tad01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     TRIADDRAFT_50632
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 408 aa AA seqDB search
MQMGTLLSWEKAEGDELEDGDLLASIETDKATMDWETPEAGYLAKIVTPEGTKDIPVGKL
VCIIVENKEDINAFKDFKDEGGEVTEAVSVSSETVHEPARSQEEKPMQQSVDTTSAKSAL
TPAGDRIFASPLARSIASEQGVDLASIAGSGPGGQIRKDDVLNFASTPTTTAAPPSEAQY
VDIPISGVRKIIANRLSESKQTIPHYYLTVDINVDEILSLRKRFNDMANGNYKLSVNDFV
VKAAALSMKEVPEVNSSWHDTYIRQYKGVDVSVAVDTGTGLITPIIFDAHNKGLSSISSD
VTSLALRARENKLKPEEFQGGTFTISNLGMFGIKQFTAIINPPQACILAVGTTEKRMIPD
NDVESGYSTATFMSVTLSCDHRIVDGATGARWLSVFRSLMEKPETMLL
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatgggtacccttttaagctgggaaaaggcagaaggtgatgaattggaagacgga
gatctcctggcttcaattgaaacagataaagccactatggactgggaaactcctgaggct
ggctacctagcaaaaattgttactccagaaggcactaaagatattccagtcggcaagttg
gtttgtatcatcgtggaaaacaaagaagatattaatgcatttaaagattttaaggatgaa
ggtggagaagtaactgaggctgtgtcagtatcatctgagactgtacacgaaccagctcgt
agccaagaggagaaaccaatgcaacaatctgtcgatactacttcagcaaaaagtgctctc
acccctgctggtgatagaatttttgcctctcctttagcccgtagcattgcaagtgaacag
ggggttgatttagcttccatcgctggatctgggcctggaggacaaatcaggaaagatgac
gtcctaaattttgcatccactccaactactactgcagctcctccctctgaagctcaatac
gtcgatattcctatttccggagttcgaaaaatcattgccaacaggctatcggaatcaaag
caaactatacctcactattatttaacagtagatattaatgttgatgaaatcttaagtcta
cgaaagcgattcaacgatatggcaaatggtaattataaattatctgtcaacgactttgta
gttaaagcagcagctttatctatgaaagaggttccagaagtcaactcttcctggcacgat
acttatatccgacagtataaaggtgttgatgtaagtgtagctgttgatacaggtaccggt
ttgattacacccataatatttgacgcacataacaagggtttgtcaagtattagtagtgac
gttacatcgttagctttaagggctagagaaaataaattaaagccggaagaatttcagggt
ggcacttttactatatcaaatctgggtatgtttggtatcaaacagtttactgcaataatt
aatcctccccaggcttgtatactagcagttggtactactgaaaaacgcatgattccggat
aatgatgttgaatctggttactccacggctaccttcatgtctgtaacattaagttgtgac
catcgtatcgttgatggggccacgggggctcgttggctatctgtttttagaagtttaatg
gaaaaaccggaaactatgctgctatga

DBGET integrated database retrieval system