KEGG   Trichoplax adhaerens: TRIADDRAFT_50661Help
Entry
TRIADDRAFT_50661  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
tad  Trichoplax adhaerens
Pathway
FoxO signaling pathway
mTOR signaling pathway
Dorso-ventral axis formation
TGF-beta signaling pathway
Class
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:tad04350]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:tad04068]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:tad04150]
Organismal Systems; Development; Dorso-ventral axis formation [PATH:tad04320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 365 aa AA seqDB search
MANASQAIRSTCEVVRGQVFDVGPRYKDSSYIGEGAYGIVCSAFDNLAGVKVAIKKVSPF
EHQTYCQRTLREIKILTRFKHENIIGIFDILCAPSAEEMKDVYIVQALMETDLYKLLKTQ
RLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPEHD
HTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNH
ILQVLGTPNMEDLQCIRNEKARGYIQSLPYNATMPWIKLFPKADSRALDLLDKMLTFNPN
KRITVEEALAHSYLEQYYDPSDEPIAEEPFRFDTEFDDLPKDRLKELIFEEVQQFKKTRV
KEGEN
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggctaacgcatcacaagcgataagatccacttgcgaagtagtacgcggtcaagtattc
gatgttggaccacgttataaagactccagttatatcggtgaaggcgcttacggtatagtt
tgttctgcctttgataatttggctggtgtcaaggtagccattaagaaggttagccctttc
gagcatcagacatattgccaacggactctgagagaaattaaaatcttaacaagatttaag
cacgaaaatataattggtatctttgatattttatgtgcaccgtcagcggaggaaatgaaa
gatgtttacatcgttcaagcactaatggaaacggatttatacaagttacttaaaacgcaa
agattaagtaatgatcatgtatgctacttcctatatcaaattttacgtggcctaaaatat
attcactcggccaatgtcttgcaccgtgatcttaaaccaagcaacttactcttaaataca
acctgcgatttaaagatatgcgattttggattggcccgtgtagcagatccagagcatgat
cacactggatttctaacggaatacgttgcgactcgttggtatcgtgcaccagagattatg
ctgaattcgaaaggatacactaaatcaattgatatttggtcagttggttgcatattggct
gaaatgttatctaatcgtcctatctttcctggaaagcattatctcgatcagttaaatcat
attttacaagttttgggaacccctaacatggaagatttgcaatgtatcaggaacgaaaag
gctcgcggatatattcaatccttaccatataatgctaccatgccctggatcaaattattc
ccaaaggcagattcaagagcgcttgatcttcttgacaaaatgctaaccttcaatccaaac
aaaagaattacagttgaagaagctttagctcattcttatttagaacaatattatgatcct
tccgatgagccgatcgcagaagaaccgtttcgctttgatactgaattcgatgacttgcca
aaggatcgtctgaaagaactaatattcgaggaagtgcaacaatttaagaagactagggta
aaagaaggtgaaaactaa

DBGET integrated database retrieval system