KEGG   Trichoplax adhaerens: TRIADDRAFT_50853Help
Entry
TRIADDRAFT_50853  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
tad  Trichoplax adhaerens
Brite
Enzymes [BR:tad01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TRIADDRAFT_50853
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 408 aa AA seqDB search
MPVRMSTENEWPMAEVVSRRDLGNGEFEYYVHFIDYNKRLDEWVHEKRLNFARMTYPKDG
KKSTSSLPASPNNKKVNGIGRKRKAVEIAPTIENGQEIKEGPPPKSGSLRQTNADGSDVI
TRMKNIDVIEFGRYQIKPWYFSPYPEQLTRANVIFICEFCLKYIGSPSAFARHRDKCKLY
HPPGNEIYRKGKLSFFEVDGRKNKIYCQNLCLLAKLFLDHKTLYYDTEPFLFYILTEFDN
KGFHTVGYFSKEKESSEDYNVACILTLPPYQRKGYGKVLIEFSYVLSKFEGKLGSPEKPL
SDLGLLSYRSYWSQAILEILSKYLDESNGSTPNITINEICDATSMRKEDVISTLQHLDLI
RYYKGQYILTLSKDIIDGHCRSFSKRKVRIDSKCLIWTPKDWAKRGRW
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgccagtaagaatgtcaacagaaaacgaatggccaatggcagaagttgttagtagaaga
gacttgggaaatggcgaatttgaatattatgttcacttcattgattataataagagatta
gatgaatgggttcacgaaaagcgcttaaattttgcacgaatgacatatccaaaggacggc
aaaaaaagtactagtagtctgccagcctctcctaataataagaaggtaaacgggatagga
agaaagcggaaagctgtggagattgccccaacaatagagaacggacaggaaattaaagaa
ggccctccaccaaaatctggcagtttacgtcaaaccaatgctgatggtagtgatgtaatc
acgcgaatgaaaaatatcgacgtgattgaatttggtcgatatcagataaagccttggtat
ttttctccttaccctgagcaattaactcgagcaaatgtcatattcatttgcgaattttgt
ctcaagtatatcggttcgccaagtgcatttgcaagacatagagataagtgtaaattgtat
catcctcctggtaatgaaatctatcgcaaaggaaaattgtctttttttgaagttgatgga
cgtaagaataagatctactgtcaaaacctctgtttactggcgaaattatttctcgaccat
aaaactttatattacgatacagagcctttcttgttttatattttaacagaatttgacaat
aaaggctttcataccgtcggttacttctctaaggaaaaagaatcaagtgaagattataat
gttgcatgcattcttacacttccaccttaccaacgaaagggatacggaaaagtcttaatt
gaatttagttatgtcctatccaagtttgaaggtaaactaggttcaccagaaaaaccacta
tctgatttgggtttattatcatacagaagctactggtcacaagcgatattagaaattcta
tcgaagtatttggatgagtctaatggaagtactccaaatatcacaataaatgaaatctgc
gacgctactagcatgcgtaaggaggatgtaatatccacactgcaacatttggatcttatt
cggtattataaaggtcaatacattctgacgttatctaaggacatcattgatggacattgc
agatcgtttagcaaaagaaaagtgcgcatcgattcaaaatgtctaatatggacgccgaaa
gattgggctaaaagaggtcgctggtag

  All links  
No link information was found.   
DBGET integrated database retrieval system