KEGG   Trichoplax adhaerens: TRIADDRAFT_50992Help
Entry
TRIADDRAFT_50992  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
tad  Trichoplax adhaerens
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 358 aa AA seqDB search
MADDDGAGNWCLIDSDPRIFTELIKGFGVTGVQVEELWSLEKEEFEKLKPIHGLVFLFKW
RPGEETVGSLVQDSRQIYFAKQVINNACATQAVLSVLLNCNHKDVQLGEMLYKFKEFSAD
FDPTMRGLSLSNMDIIRQVHNSFARQQMFEFENSSNKSEEAFHFVAYVPINGRLYELDGL
KDGPIDLGKCGEDWITAVKPILESRMTSYATGEIRFNLMAVVSDHKMKLEADLEKLQSNL
SDLEGKLSKLDTKKDTEAYLKLKNEYATVELKMNEANHQLRVEEEKRLRYKIEHAKRDHN
YLPMIVQLLKCLAKDGRLVELTEKAEQRQKAVTAAALERRKRKLDSGKESSDDKDSGK
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgatgacggtgccggaaattggtgcctgattgatagtgatcctcgcatcttt
accgaactcataaagggttttggtgttactggagtacaagttgaagagttatggtcccta
gagaaagaagaatttgagaaattgaagccaattcatggtttggtatttctattcaaatgg
cgccccggtgaagaaactgtaggttctctggtgcaagattctcgacaaatctactttgcc
aaacaggtaattaacaatgcatgtgcaactcaagccgtcctaagtgtattactaaactgt
aaccacaaagacgtccagttaggagagatgttatacaagttcaaggaatttagtgctgat
tttgatccgacaatgcgtggcttgagtttaagtaatatggatattataagacaggtgcac
aacagctttgctagacaacaaatgtttgaattcgagaactcatccaataagtctgaagaa
gctttccactttgtagcctatgtacctattaacggacgtctatatgagctggatggatta
aaagacggaccaatcgatttaggcaaatgcggtgaggattggattacagcagtaaagcca
attttggaatctcggatgacaagctatgcaaccggcgagattcgatttaatttgatggca
gtagtatcagatcacaaaatgaaattggaagcagatctagaaaagttacaatctaattta
tccgatctggaagggaaattatccaaattggatacaaaaaaagacaccgaagcttatctc
aagttaaaaaatgaatatgctactgttgaactcaagatgaatgaagctaatcatcaacta
cgagtagaagaagaaaaacgtctgcgatacaaaattgagcatgcaaagcgagaccataat
tatctaccaatgattgtgcaactactaaagtgcttggccaaggatggccgtctggtagaa
ctgacggaaaaggccgaacagcgtcaaaaagcggtaactgccgcagcactggaaaggaga
aagaggaaattggactctggtaaagagagtagtgatgacaaagattctggaaagtag

DBGET integrated database retrieval system