KEGG   Trichoplax adhaerens: TRIADDRAFT_50999Help
Entry
TRIADDRAFT_50999  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
tad  Trichoplax adhaerens
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tad00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    TRIADDRAFT_50999
Enzymes [BR:tad01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     TRIADDRAFT_50999
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 434 aa AA seqDB search
MRQLFSSAKALYDASSDVQILTDADFRTRVLQSDQLWLVEFYAPWCGHCQRLAPEWSKAA
TSLKGIVNVGAVDMDKYPSVGAPYNIFAADKNHPSDYNGARTSQAIVEHAFNALREMTQK
RAGGSSGGSGSSGGSGSSGGSSSDSNSSGSNDVVEITDGNFEEKIINSKEMWLVEFYAPW
CGHCKNLAPEWARAATRLKGKVNLAAVDATANTIVANKYEVKGFPTIKFFPGGKKDFSSA
EDYTGGRTASDIVNWAEEKYAENAEPPEIIELVNAEVFDETCKNKQLCVISFLPNILDTG
ASGRNKFLELIHGLGDKFKRKQWGWLWCAAGTQSKLESAVGVGGYGYPAMIALNPRKSLF
AELKLAFSEQTVNEFLKELSYGRGSTAALRGEGLPEILTIDSWDGKDGQLPEEEEFDLSE
LGITVNADDSKDEL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagacaactgttttcgagtgcaaaggctctgtatgatgcatcatctgatgtacagatc
ttgactgatgctgatttcagaactcgtgttttacaaagtgatcagttgtggctggtggag
ttttatgccccctggtgtggacattgccagaggctagcaccggaatggtctaaagctgca
acttcactaaaggggatagtaaatgttggagctgttgacatggataaatatccttctgtt
ggggccccatacaatatatttgcagctgataagaatcacccaagcgattataatggagct
agaacttcacaggctatcgttgaacatgcattcaatgcacttcgagaaatgacacaaaaa
cgtgctggcggtagtagtggtggtagcggtagcagcggcggtagcggcagcagcggtggt
agcagcagtgatagcaattcctcgggatcgaacgatgtagttgaaatcactgatggtaac
ttcgaagaaaagattatcaacagcaaagagatgtggttagtagaattttatgctccctgg
tgtgggcattgtaaaaatttagctccagaatgggctagggctgctactcgtctaaaaggt
aaagttaacctggctgcggttgacgctacagctaatactattgtggctaataagtacgag
gtcaaaggatttcctactattaagttctttcctggaggcaagaaagacttcagcagtgct
gaagactatactggtggtcgcactgcatctgatattgtcaattgggctgaagagaaatat
gctgaaaatgccgaaccccctgagatcatagaattagtaaacgcagaggtgttcgatgaa
acttgtaaaaataaacaattatgtgtaatttccttcttgccaaatatcttggacactggt
gctagtggacgaaataaatttcttgagctgatacatggacttggtgataaatttaaaaga
aagcaatggggttggttatggtgcgctgctggtacacaatccaagttggagagcgctgtt
ggtgttggtggatatggctatccagcaatgattgcgcttaatcctcggaaaagtctgttt
gcggaattgaagctagcatttagtgagcagactgttaatgaatttttaaaagaattatca
tatggccgtggatcaactgcagcccttcgtggcgaaggactacccgaaattttgacaatt
gatagttgggatggcaaagacggccaattgccagaagaagaagaatttgatttaagcgaa
ctaggcataactgtaaatgctgatgatagtaaagatgaattgtag

DBGET integrated database retrieval system