KEGG   Trichoplax adhaerens: TRIADDRAFT_50999Help
Entry
TRIADDRAFT_50999  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K09584  protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
tad  Trichoplax adhaerens
Pathway
tad04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tad00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    TRIADDRAFT_50999
Enzymes [BR:tad01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     TRIADDRAFT_50999
Chaperones and folding catalysts [BR:tad03110]
 Protein folding catalysts
  Protein disulfide isomerase
   TRIADDRAFT_50999
Membrane trafficking [BR:tad04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    TRIADDRAFT_50999
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_7 Thioredoxin_8 Thioredoxin_2 Thioredoxin_9 OST3_OST6 Thioredoxin_3 AF-4 DLIC Herpes_capsid
Motif
Other DBs
NCBI-GeneID: 6758370
NCBI-ProteinID: XP_002117070
JGI: 50999
UniProt: B3SA60
AA seq 434 aa AA seqDB search
MRQLFSSAKALYDASSDVQILTDADFRTRVLQSDQLWLVEFYAPWCGHCQRLAPEWSKAA
TSLKGIVNVGAVDMDKYPSVGAPYNIFAADKNHPSDYNGARTSQAIVEHAFNALREMTQK
RAGGSSGGSGSSGGSGSSGGSSSDSNSSGSNDVVEITDGNFEEKIINSKEMWLVEFYAPW
CGHCKNLAPEWARAATRLKGKVNLAAVDATANTIVANKYEVKGFPTIKFFPGGKKDFSSA
EDYTGGRTASDIVNWAEEKYAENAEPPEIIELVNAEVFDETCKNKQLCVISFLPNILDTG
ASGRNKFLELIHGLGDKFKRKQWGWLWCAAGTQSKLESAVGVGGYGYPAMIALNPRKSLF
AELKLAFSEQTVNEFLKELSYGRGSTAALRGEGLPEILTIDSWDGKDGQLPEEEEFDLSE
LGITVNADDSKDEL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagacaactgttttcgagtgcaaaggctctgtatgatgcatcatctgatgtacagatc
ttgactgatgctgatttcagaactcgtgttttacaaagtgatcagttgtggctggtggag
ttttatgccccctggtgtggacattgccagaggctagcaccggaatggtctaaagctgca
acttcactaaaggggatagtaaatgttggagctgttgacatggataaatatccttctgtt
ggggccccatacaatatatttgcagctgataagaatcacccaagcgattataatggagct
agaacttcacaggctatcgttgaacatgcattcaatgcacttcgagaaatgacacaaaaa
cgtgctggcggtagtagtggtggtagcggtagcagcggcggtagcggcagcagcggtggt
agcagcagtgatagcaattcctcgggatcgaacgatgtagttgaaatcactgatggtaac
ttcgaagaaaagattatcaacagcaaagagatgtggttagtagaattttatgctccctgg
tgtgggcattgtaaaaatttagctccagaatgggctagggctgctactcgtctaaaaggt
aaagttaacctggctgcggttgacgctacagctaatactattgtggctaataagtacgag
gtcaaaggatttcctactattaagttctttcctggaggcaagaaagacttcagcagtgct
gaagactatactggtggtcgcactgcatctgatattgtcaattgggctgaagagaaatat
gctgaaaatgccgaaccccctgagatcatagaattagtaaacgcagaggtgttcgatgaa
acttgtaaaaataaacaattatgtgtaatttccttcttgccaaatatcttggacactggt
gctagtggacgaaataaatttcttgagctgatacatggacttggtgataaatttaaaaga
aagcaatggggttggttatggtgcgctgctggtacacaatccaagttggagagcgctgtt
ggtgttggtggatatggctatccagcaatgattgcgcttaatcctcggaaaagtctgttt
gcggaattgaagctagcatttagtgagcagactgttaatgaatttttaaaagaattatca
tatggccgtggatcaactgcagcccttcgtggcgaaggactacccgaaattttgacaatt
gatagttgggatggcaaagacggccaattgccagaagaagaagaatttgatttaagcgaa
ctaggcataactgtaaatgctgatgatagtaaagatgaattgtag

DBGET integrated database retrieval system