KEGG   Trichoplax adhaerens: TRIADDRAFT_51430Help
Entry
TRIADDRAFT_51430  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
tad  Trichoplax adhaerens
Pathway
tad00600  Sphingolipid metabolism
tad01100  Metabolic pathways
Module
tad_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    TRIADDRAFT_51430
Enzymes [BR:tad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     TRIADDRAFT_51430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 6748896
NCBI-ProteinID: XP_002108481
JGI: 51430
UniProt: B3RJ69
AA seq 536 aa AA seqDB search
MEEIRISNKSTTLISQIIMQDTLQLIWPRNKLRPCHVVLTQNQMCIKVSDSGPPASLLGD
DGVIQLKDVIGCKVSRGTSTKRRDRGGYLTLFWYPMRKKKIGSACKRISIPVYLRVAQSK
EVEDNIKIADQWHAAIICALRGIKYQPDLGSKSCPAPRKLLVFINPCSGSGKASKIFNGK
SKDILNEADILCEVVTTERVGHAKDYIINANLSKWDGILVVSGDGLIYEVINGLNERQDW
DTVRHMPIGILPAGSGNALYASIMKFSGEPNDIVSATFIIAKYSTRPLDLMHLQSKKNNF
LAFLSIGWGMIADIDIKSEKFHFLGSNRFTVEAVSMIAKRKVYRGKISYLPCDKEPEETR
ESQWTNNGNVSERSAVMDETFNFHNDDDMNVTQLDANHQQSAILTVGDDSNPIPSLDKPL
PNQWKVIDQDFITVVIGNLPYLSTDFLFAPPSRLDDGKAYIVAVSDKVNRKGLTKILLST
KNGQYIESPDVQLIPCKAFRLVPETEGGYLTVDGEVVDYGPIQGTVEKGGLQVFCL
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaattcgtatatccaataagtcgacaacgttaattagccaaattatcatgcaa
gatacattacaattaatatggcctagaaataagctaaggccttgccatgtcgtcttaact
cagaatcaaatgtgtattaaagtatccgatagtggccctccagcatcactactaggtgat
gatggcgtaatacaactaaaagatgttattggctgtaaagtatcaagaggtacatcgacg
aaacgccgtgatcgtggtggctatttgaccttattttggtatccaatgcgcaagaaaaag
attggttccgcttgtaagagaatttctattccagtctatttacgtgttgcccaatcgaag
gaagtagaagacaacatcaagattgcagatcaatggcatgcagccattatatgcgctttg
cgtggtatcaagtatcaaccagatctaggatcaaaatcttgcccagcaccacgaaaattg
ttggtttttattaacccttgtagtggatctggtaaagctagtaaaattttcaacggcaaa
tcaaaagatattttaaatgaagcggatatattatgcgaagttgtaactacagaacgagtc
gggcatgcaaaagactatatcattaatgctaatctttccaaatgggatggtatattagtt
gtatccggagacggattgatttatgaagttataaatggactaaatgagcggcaggattgg
gataccgtaagacatatgcctattggtattttacctgcaggatcagggaatgcactctat
gcgtccattatgaaattttcaggagagccaaatgatatcgtcagtgccacctttatcatt
gcaaaatattcaactcgtccgttggatttgatgcatttacagtcgaaaaaaaacaatttt
ctagcctttctatctataggatggggaatgattgctgatattgacatcaagtcagaaaag
tttcattttcttggttctaatcgctttactgtagaagcagtttccatgattgctaaacga
aaggtctatcgaggcaaaatatcttacttaccttgtgacaaggagcctgaagaaactcga
gaatctcaatggacgaataatggcaatgtcagtgaacgttctgctgttatggatgaaaca
tttaactttcacaacgatgatgatatgaatgttacacaattggatgccaaccatcaacaa
tctgctattctgacagttggcgatgattcaaatcctataccatcacttgataaacctcta
ccgaatcaatggaaagtaattgatcaggatttcattacagttgtcatcggtaatttgcct
tatttatcgacggatttcctatttgcaccgccatcaagactagatgatggcaaggcatat
attgtggcagtcagtgataaagttaatcgtaaaggattaactaaaatactcttatcaacc
aagaatggacaatacattgaatcgcctgatgttcagttaataccatgcaaagcatttcgt
cttgtaccagaaactgaaggtggatatttaaccgtagatggtgaagtagtggattatggc
ccaattcagggtaccgttgaaaaaggtggactgcaagtattttgtttataa

DBGET integrated database retrieval system