KEGG   Trichoplax adhaerens: TRIADDRAFT_51484Help
Entry
TRIADDRAFT_51484  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K04458  
receptor-type tyrosine-protein phosphatase R [EC:3.1.3.48]
Organism
tad  Trichoplax adhaerens
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 562 aa AA seqDB search
MSSVCMPFTPDADRESVSSPLLRDANFQDTAIAKRDPDDDTILPVRQKRAMAITTVKPTT
FKSTAHTTLFLLKDVSRQYIVVAGSKILHNIETNAVIANVDMVIAMESSSFTADRRAEFV
YGIAAALHVPARNVIIDKIMESDVIIEFYVIKPHVTQSTFHLDANSNLSKILYPAKDVVE
KLTPSVLRTYLSEFKVTDVHPKYKFNNGPKEHELTIWNQYWFIGAMATALWRRYKFRKQE
IEHRDFEKQLPLLLPGHSPLGNSEQRYIQPWDDPSVVENDWLQVSQYQSHPRSLAARRNV
PRLPLPLGANVIKPVNPSPPRDEIFQRKSRVLDRQELQEALDNGYKNEPRAFIATQGPLP
NTIDDFWRMVWFQNVSLIIMITKVREKNLNKCEYYWPNSDQGQVTYGEIKVTLENICERE
GYIVSQLKLENTKITESPRYVYHFWYTSWPDHGAPDSARQLLQLVKEVRVKRQELSTGPI
VVHCSAGIGRTGCFIAISIGIIQYEMERVVDILNIVSSMREDRGGLVQTLEQYEFVYKAM
YLFSREYDNNRSRPLVLGNTLN
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccgtatgtatgccattcacacccgatgctgatcgagagtcagtcagttcaccg
ctgttacgagacgccaacttccaagatactgcaatcgctaaaagagatccagatgatgac
acaatattaccagttagacagaaacgggcaatggcaatcacaacggtcaagccaacaaca
ttcaaatcgacagcccatactacgctttttttactgaaagatgtcagcagacaatatatt
gttgtggctggtagtaaaatcttgcataatattgaaacgaacgctgtaatagctaatgtc
gatatggtaatcgctatggaatcttcgtcttttacagccgacagaagagctgaatttgta
tatgggattgctgctgcattgcatgtaccagcacgaaatgttattattgataaaattatg
gaaagcgatgttattatcgaattctatgtgataaaacctcacgttacacagtcgacattt
catctggatgccaactcaaatttaagcaagattctataccctgctaaagacgtagtagaa
aagttaacacctagtgtacttagaacttacttgtctgaatttaaggtgactgatgttcat
cctaagtataaatttaataatggccccaaagaacatgaattaactatttggaatcagtac
tggtttattggagccatggcaacggcattatggcggcgttataaatttcgaaagcaagaa
atagaacatagagatttcgagaaacaacttcctctattacttcctggacattcaccgctt
ggtaatagtgaacagagatatatacaaccatgggatgatccaagtgtcgttgagaacgat
tggttacaagtatcacaatatcaatcgcatccacgaagcctagcagcgaggcgtaatgta
ccgagactgccgttacctttaggagctaatgttataaagccggtaaatcctagtcctcct
agagatgagatatttcaaagaaaaagtcgtgtattagacaggcaagagctacaggaagcg
ttggacaatggttataagaatgaacctcgcgcttttattgctactcaagggccgcttcca
aacactatcgatgatttttggagaatggtctggtttcaaaatgtttcacttataattatg
attacgaaagtccgagaaaagaatcttaataaatgtgaatattattggccaaattctgat
caaggccaagttacttatggcgaaattaaggttactttagaaaatatctgcgaaagagag
ggatatatagttagtcaacttaagcttgaaaataccaagatcacggaatcacctaggtat
gtctatcacttttggtatacttcttggccagaccatggtgctcctgattcagctaggcaa
cttttacagctagtaaaagaagttagagtaaaacgacaggaattgtctaccggtcctatt
gtagtacattgcagtgctggcattggacgcaccggttgtttcatcgcgataagcattggt
ataatacaatacgagatggaaagagtggtagatattttaaatatagtttcatcgatgcgg
gaagacagaggaggactggttcagacattggaacaatatgaatttgtatataaagcaatg
tatttatttagtcgagaatacgacaataataggagtagacctctcgtattgggaaatacg
cttaattga

DBGET integrated database retrieval system