KEGG   Trichoplax adhaerens: TRIADDRAFT_51484Help
Entry
TRIADDRAFT_51484  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K04458  
receptor-type tyrosine-protein phosphatase R [EC:3.1.3.48]
Organism
tad  Trichoplax adhaerens
Brite
Enzymes [BR:tad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     TRIADDRAFT_51484
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 562 aa AA seqDB search
MSSVCMPFTPDADRESVSSPLLRDANFQDTAIAKRDPDDDTILPVRQKRAMAITTVKPTT
FKSTAHTTLFLLKDVSRQYIVVAGSKILHNIETNAVIANVDMVIAMESSSFTADRRAEFV
YGIAAALHVPARNVIIDKIMESDVIIEFYVIKPHVTQSTFHLDANSNLSKILYPAKDVVE
KLTPSVLRTYLSEFKVTDVHPKYKFNNGPKEHELTIWNQYWFIGAMATALWRRYKFRKQE
IEHRDFEKQLPLLLPGHSPLGNSEQRYIQPWDDPSVVENDWLQVSQYQSHPRSLAARRNV
PRLPLPLGANVIKPVNPSPPRDEIFQRKSRVLDRQELQEALDNGYKNEPRAFIATQGPLP
NTIDDFWRMVWFQNVSLIIMITKVREKNLNKCEYYWPNSDQGQVTYGEIKVTLENICERE
GYIVSQLKLENTKITESPRYVYHFWYTSWPDHGAPDSARQLLQLVKEVRVKRQELSTGPI
VVHCSAGIGRTGCFIAISIGIIQYEMERVVDILNIVSSMREDRGGLVQTLEQYEFVYKAM
YLFSREYDNNRSRPLVLGNTLN
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccgtatgtatgccattcacacccgatgctgatcgagagtcagtcagttcaccg
ctgttacgagacgccaacttccaagatactgcaatcgctaaaagagatccagatgatgac
acaatattaccagttagacagaaacgggcaatggcaatcacaacggtcaagccaacaaca
ttcaaatcgacagcccatactacgctttttttactgaaagatgtcagcagacaatatatt
gttgtggctggtagtaaaatcttgcataatattgaaacgaacgctgtaatagctaatgtc
gatatggtaatcgctatggaatcttcgtcttttacagccgacagaagagctgaatttgta
tatgggattgctgctgcattgcatgtaccagcacgaaatgttattattgataaaattatg
gaaagcgatgttattatcgaattctatgtgataaaacctcacgttacacagtcgacattt
catctggatgccaactcaaatttaagcaagattctataccctgctaaagacgtagtagaa
aagttaacacctagtgtacttagaacttacttgtctgaatttaaggtgactgatgttcat
cctaagtataaatttaataatggccccaaagaacatgaattaactatttggaatcagtac
tggtttattggagccatggcaacggcattatggcggcgttataaatttcgaaagcaagaa
atagaacatagagatttcgagaaacaacttcctctattacttcctggacattcaccgctt
ggtaatagtgaacagagatatatacaaccatgggatgatccaagtgtcgttgagaacgat
tggttacaagtatcacaatatcaatcgcatccacgaagcctagcagcgaggcgtaatgta
ccgagactgccgttacctttaggagctaatgttataaagccggtaaatcctagtcctcct
agagatgagatatttcaaagaaaaagtcgtgtattagacaggcaagagctacaggaagcg
ttggacaatggttataagaatgaacctcgcgcttttattgctactcaagggccgcttcca
aacactatcgatgatttttggagaatggtctggtttcaaaatgtttcacttataattatg
attacgaaagtccgagaaaagaatcttaataaatgtgaatattattggccaaattctgat
caaggccaagttacttatggcgaaattaaggttactttagaaaatatctgcgaaagagag
ggatatatagttagtcaacttaagcttgaaaataccaagatcacggaatcacctaggtat
gtctatcacttttggtatacttcttggccagaccatggtgctcctgattcagctaggcaa
cttttacagctagtaaaagaagttagagtaaaacgacaggaattgtctaccggtcctatt
gtagtacattgcagtgctggcattggacgcaccggttgtttcatcgcgataagcattggt
ataatacaatacgagatggaaagagtggtagatattttaaatatagtttcatcgatgcgg
gaagacagaggaggactggttcagacattggaacaatatgaatttgtatataaagcaatg
tatttatttagtcgagaatacgacaataataggagtagacctctcgtattgggaaatacg
cttaattga

DBGET integrated database retrieval system