KEGG   Trichoplax adhaerens: TRIADDRAFT_51956Help
Entry
TRIADDRAFT_51956  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
tad  Trichoplax adhaerens
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    TRIADDRAFT_51956
Enzymes [BR:tad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     TRIADDRAFT_51956
    2.7.1.82  ethanolamine kinase
     TRIADDRAFT_51956
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 354 aa AA seqDB search
MAETNDALVAVGKENVLNYCKQVIGGIWEKADLTNVQFETVRLSENLQSTNNNEPEKVLI
RVYGETAAKGQLLLQESVIVSLLGEIKLAPKIYGFFPGGRFEEFLNGRTLKTSELQLQNV
SEKMAVCFANLHQACMPISKKPTWSSDFIDRLFDSATTITFNDKNKQARYEEILSYDLAA
RRDEIRDILQACNSEACFCHNDLQENNIIVCGDPTSADASFHCIDFEYGGYNYSAFDLAN
YFCEWCYDYNCDKPPYFTYCLDDYPSDKQQIHFLSCYLKKQYQLKKVLVDEKTLSSELRK
LQLEVNRLALASHLLWTIWACVQAKMSNIEFGYLEYSLARLKGYMRQKNRPNLW
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaccaatgatgctttagtcgctgtaggcaaggaaaatgttcttaactactgt
aaacaagttattggaggtatttgggaaaaagctgatttaactaacgtacaatttgagacg
gtcagactatcagaaaatttgcaatcgaccaataataatgaacctgaaaaggtactgatt
agagtctatggagaaacagccgccaagggccaacttttactgcaagagtcagtaatagtt
tcgttactgggtgaaataaaactagctccgaagatatatggattctttcctggtggtcga
tttgaagaatttcttaatggaagaacgttaaagactagcgaactacaacttcagaatgtt
tcagagaaaatggcggtctgtttcgcaaatttgcatcaggcatgcatgccaatttctaag
aaaccaacctggtcctctgattttatagaccgtctatttgattctgcaactaccataaca
tttaatgacaaaaataaacaagctagatatgaagaaattttatcctatgaccttgctgcc
cggagagacgaaattcgggatattctacaagcgtgcaattcggaggcatgcttctgccat
aatgacctgcaagaaaataatatcatcgtgtgtggagatccaacatcagctgatgcttcg
tttcattgcatagactttgaatatggcggctataactacagtgctttcgatcttgcaaat
tacttttgcgaatggtgctacgattacaattgcgataagcctccttacttcacatattgc
ttggacgactatccttcagacaagcaacagatacattttctttcatgctacctaaaaaag
caatatcagttaaagaaagttctagtagacgaaaagaccctatcttcggagctaagaaaa
ttacaattggaagttaacaggttagccctagcttctcatcttctttggactatctgggcc
tgtgttcaagcaaaaatgtcaaacatagagtttggatatttggaatattctcttgcccgt
ttaaagggttatatgagacagaaaaatagaccaaatctgtggtaa

DBGET integrated database retrieval system