KEGG   Trichoplax adhaerens: TRIADDRAFT_52000Help
Entry
TRIADDRAFT_52000  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K10886  
DNA-repair protein XRCC4
Organism
tad  Trichoplax adhaerens
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:tad00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    TRIADDRAFT_52000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 337 aa AA seqDB search
MEEKYLCRIEAAGQKYYLMTSWENDDVDQLCKLFLTDGQSAWHTVVTDGVANRLARSVQM
DLHEYLKQTKKAFTANSSANSNFHFGVSLLPDHNTVEFAWKKYLRSEDMKFQLGKLKMAA
VTDPKAIISELFDFSLSQISNLKMNIASLNSTNERLSSERAESLKNLEEFVVTKENLEVD
MYGKFIRVLNSKKNKIRTLTNQVRNMPTFPTSVKMEEKIKVEKEEEDDLLLPGTSHSGPG
TSSTSTENENSLPSSSLMLEDTVSNICVAPTAKRRKRRGAAIKSDADDLPALPKTRSLRK
NSSQLSRNNSTGSNSSQGRLKRNSSALPGAEDLMEEI
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggaggagaaatatctttgtcgtattgaagctgctggtcagaagtattacttgatgact
tcatgggagaatgacgatgtcgatcaattgtgtaagctcttcttaaccgatggccaaagt
gcttggcatactgtagttaccgatggtgttgctaaccgattggctagaagtgttcaaatg
gacttgcatgaatatttaaaacagacaaagaaagcatttacagcaaattcttccgccaat
tctaattttcacttcggcgtctccttgctgccggaccataacactgtcgagtttgcttgg
aagaagtacctaagaagcgaagatatgaaatttcagcttggtaaattaaaaatggccgca
gtcactgacccgaaagcaattataagcgaattatttgatttcagcttgagccaaatttcg
aacttaaaaatgaatattgcatcgcttaattctacaaatgaacgtctatctagcgagaga
gctgaatctctcaagaatctcgaggaatttgtagttacaaaagagaacttagaagtggac
atgtatggcaaattcattcgagtactcaatagcaagaagaataaaattaggacacttaca
aatcaagttaggaatatgcccacgtttcctaccagtgtcaagatggaggagaaaattaaa
gtcgagaaagaggaagaagacgatttattattgccgggtacaagtcatagtggacctggt
actagctcgacctccactgaaaatgaaaatagcttaccgagttcaagtttaatgcttgaa
gatactgttagtaatatttgtgtcgcacctacagctaagaggagaaagcgccgaggagca
gcaataaagtcggatgctgacgatcttccagctttacctaaaacccgttctctacgtaaa
aattccagtcaattatctagaaataatagcacggggtcaaattcatcacaaggacgtctc
aaaagaaacagttcagctctaccgggagctgaagatctgatggaagaaatttaa

DBGET integrated database retrieval system