KEGG   Trichoplax adhaerens: TRIADDRAFT_52223Help
Entry
TRIADDRAFT_52223  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
tad  Trichoplax adhaerens
Pathway
tad00062  Fatty acid elongation
tad00071  Fatty acid degradation
tad00280  Valine, leucine and isoleucine degradation
tad00310  Lysine degradation
tad00380  Tryptophan metabolism
tad00410  beta-Alanine metabolism
tad00640  Propanoate metabolism
tad00650  Butanoate metabolism
tad01100  Metabolic pathways
tad01200  Carbon metabolism
tad01212  Fatty acid metabolism
Module
tad_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    TRIADDRAFT_52223
   00650 Butanoate metabolism
    TRIADDRAFT_52223
  Lipid metabolism
   00062 Fatty acid elongation
    TRIADDRAFT_52223
   00071 Fatty acid degradation
    TRIADDRAFT_52223
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TRIADDRAFT_52223
   00310 Lysine degradation
    TRIADDRAFT_52223
   00380 Tryptophan metabolism
    TRIADDRAFT_52223
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TRIADDRAFT_52223
Enzymes [BR:tad01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     TRIADDRAFT_52223
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 6749313
NCBI-ProteinID: XP_002108831
JGI: 52223
UniProt: B3RM37
AA seq 304 aa AA seqDB search
MSRIFSIATRSILPRSYRPVASQLSKYSLAGHGKIFYSTAGTENNDYKEIIVEYKGKRQN
VALVRLHRPKALNALCASLIAELTHALASFDKNPDIGCIVLTGSEKAFAAGADIKEMQNL
TYDYTYKSDFLANWEFVHRTKTPIIAAINGYALGGGCEIAMSCDILYAGDNAKFGQPEIS
IGTIPGGGGSQRLTKAVGKSLAMEMILTGKPIDAQEAERKGLVSKVFPKEVLVDEAIKTA
EVIANQSKMAARMCKQAVQTSFNVGLDEGLKYERTIFHSTFAVHDRKEGMTAFVEKRKPN
YEDK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgaatcttctccatcgctacgagatcaatattgcctcgcagttatagacctgtt
gcatcgcaactgtcaaagtattcattagcaggtcacggcaagatattctactcaactgca
ggtaccgaaaacaacgattacaaggaaattattgttgaatataaaggaaaacgacaaaat
gtcgctcttgtccgactacatcgccccaaggcactaaatgccttatgcgcttctttgata
gcggaattaactcatgcgctcgcatcatttgataagaatccggatataggctgtatcgtt
cttaccggctctgagaaggccttcgcagcgggagcagacataaaagaaatgcaaaaccta
acttatgattatacctataaatctgattttctcgcgaactgggaatttgttcatagaacc
aaaactccaattatcgccgctattaatggttacgcattgggcggaggttgcgaaattgca
atgtcttgtgatatcctttatgctggtgataatgctaaatttggccaaccagaaataagt
attggaaccattccaggtggtggcggttcgcaaagattaaccaaagccgtaggcaaatca
ttagctatggaaatgatcctcactggcaaaccgattgatgcgcaggaagctgaaagaaaa
ggtttggtgagcaaggtttttcctaaagaagtactagtagatgaagctattaagactgct
gaagtaattgccaatcaatctaaaatggctgctagaatgtgcaagcaagcagtgcaaacc
tccttcaacgttggcttagatgagggtctaaagtatgaaagaactattttccattcaact
tttgccgtgcacgaccgtaaggaaggtatgaccgcattcgtagaaaagagaaagccaaat
tatgaagataagtaa

DBGET integrated database retrieval system