KEGG   Trichoplax adhaerens: TRIADDRAFT_52382Help
Entry
TRIADDRAFT_52382  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
tad  Trichoplax adhaerens
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TRIADDRAFT_52382
   00670 One carbon pool by folate
    TRIADDRAFT_52382
Enzymes [BR:tad01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     TRIADDRAFT_52382
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 174 aa AA seqDB search
MTRDRGIGYKNDLPWKLRNEYKYFARLTTSTKDSAKKNAVLMGRNTWVSIPEKNRPLRNR
INIVISSQLRAEEVPEGVHVVASIPEVIELVQSPLLKDIVETVWIVGGAPVYKGFMSHPQ
CDRIYLTKLDANYECDVFFPEMSDDFKEISDPDVSQEVQEENGLKYTFHVYQRN
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtgaccgtggtatcggatataagaatgatttgccatggaaacttcgaaacgaa
tataaatacttcgctcgcttaacaacgtcgaccaaagattcagccaagaaaaatgctgtt
ttgatgggacgtaatacatgggttagcattccagagaaaaatcgacctctacggaataga
attaatatagttattagctcgcaacttcgagctgaagaggtcccggaaggtgtacatgta
gtagcatctataccagaagtgatagaactcgttcagagtcctttattgaaggatatcgtg
gagactgtatggattgttggtggagcacctgtgtacaagggttttatgtcacatccacaa
tgtgatcgtatttatttaacaaaattagatgcaaactacgaatgcgatgtattttttccc
gaaatgtccgacgatttcaaagaaattagtgatccagatgtgtcacaagaggtacaagaa
gaaaatggtttaaagtacacttttcatgtctaccagaggaactaa

DBGET integrated database retrieval system