KEGG   Trichoplax adhaerens: TRIADDRAFT_52533Help
Entry
TRIADDRAFT_52533  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
tad  Trichoplax adhaerens
Pathway
Glycerolipid metabolism
Metabolic pathways
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    TRIADDRAFT_52533
Enzymes [BR:tad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     TRIADDRAFT_52533
Peptidases [BR:tad01002]
 Serine Peptidases
  Family S33
   TRIADDRAFT_52533
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
AA seq 302 aa AA seqDB search
MTTSAFDAINGLEQINNSGSPEGIVEYKLKSVFKNYSLYARHWPVASPKAIAIIIHGAGE
HCGRYDEMASLLNKESIYAFANDHIGHGRSDGEKLCLDKFETYTDDCHKHLLLVQERFPD
LKVFCIGHSLGGLIAVDLAVKIPKAFAGVVLISPCLAIAPEAASFFTIMAMKVISFFLPK
MQINRIDAKFVSRDEKEVESYNTDPLVWHGGLRAHFCKEVYDAVCKITKISKSIEWPYLV
MHGDQDKLCEISGSESFHNAARSSDKTYKRYEGFYHALHKEPVDSRKIIFEDLLKWINDR
MD
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgacgacctccgcatttgacgcaataaatggcttggaacagattaataattcagggtca
ccagaggggattgtagaatataaattaaaaagcgtcttcaaaaattattccctttatgca
agacactggcctgtagcatccccgaaagctattgctatcatcattcatggtgccggagaa
cactgtggcagatacgatgagatggcaagtcttttgaataaggaatccatatatgccttt
gcaaatgatcacattggtcacggtcggagcgatggagaaaaattatgtttggataaattt
gaaacttatactgatgactgccataaacatttactacttgttcaagaaagattccctgat
ttaaaagtattttgcattggtcactcgctgggaggattaattgccgtagatcttgctgtt
aaaataccgaaagctttcgctggagtcgtacttatttctccatgccttgcgatcgccccc
gaagctgcttctttcttcactataatggccatgaaagtgatatcatttttcctaccaaaa
atgcaaataaatcgaatagatgcaaagtttgtgtcccgggatgaaaaggaggtagaatca
tacaacactgatcctttagtgtggcatggtggtcttagagcgcatttttgtaaggaggtg
tatgatgccgtttgcaaaattaccaaaataagcaagagtatcgaatggccttaccttgtc
atgcatggtgaccaagacaaattatgtgaaattagtggatctgaaagctttcataatgca
gcccgcagcagtgataaaacatacaagagatatgagggattttatcatgcattgcataaa
gaaccggtagatagtcgcaaaattatttttgaagacttgctgaaatggatcaacgataga
atggattaa

DBGET integrated database retrieval system