KEGG   Trichoplax adhaerens: TRIADDRAFT_52855Help
Entry
TRIADDRAFT_52855  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
tad  Trichoplax adhaerens
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Brite
KEGG Orthology (KO) [BR:tad00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    TRIADDRAFT_52855
   03008 Ribosome biogenesis in eukaryotes
    TRIADDRAFT_52855
Enzymes [BR:tad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     TRIADDRAFT_52855
Ribosome biogenesis [BR:tad03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    RNase MRP
     TRIADDRAFT_52855
Transfer RNA biogenesis [BR:tad03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    TRIADDRAFT_52855
Mitochondrial biogenesis [BR:tad03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    TRIADDRAFT_52855
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 131 aa AA seqDB search
MEEGGGAEAENQEYLIRKRLPRSLPKRKNDVYVTRKTNFAAQIKKCSKLLESEFTEIHIH
GLGAAVNRAINLALQLKLTSSGGLEVSTTTSTVELFDDFESLDETLPSKKSQLRQNSAIH
IKVYKIIKVAS
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaggcggtggtgcagaagcagaaaatcaagaatatctaattcgaaagagacta
cctagatccttacctaaacggaagaatgatgtgtatgtcacacgtaaaaccaattttgct
gctcaaataaaaaaatgtagtaaactcttggaatcagaatttacagagattcatattcat
ggcctcggtgctgctgttaatagagccatcaatcttgccttgcaattaaaattgaccagc
agtggaggcttggaggtatctacgacaacatcgactgtggagttgtttgacgatttcgaa
tctcttgatgagacattaccatcgaagaaatctcaattaaggcaaaattctgctatacat
attaaagtctataaaattattaaagtagcaagctga

  All links  
No link information was found.   
DBGET integrated database retrieval system