KEGG   Trichoplax adhaerens: TRIADDRAFT_53260Help
Entry
TRIADDRAFT_53260  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
tad  Trichoplax adhaerens
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:tad00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    TRIADDRAFT_53260
  Replication and repair
   03420 Nucleotide excision repair
    TRIADDRAFT_53260
Transcription machinery [BR:tad03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     TRIADDRAFT_53260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 246 aa AA seqDB search
MYHTSTQRKYWTFPNEEEIAQHKGALHNQFFQKLKDDDSRHIRTKDLPSVEELDHLCTFY
EFELMDLCRRFDPPMPATAAVYMKRFYLVCSVMDYHPCDIMLACVYLATKVDEYNISIDK
FLTMVPENDKERAKSRTLGFELLVMEKLKFHLTIHCPYRPVEGLLINIMTVIPEIADKID
ELRRHIDKFLSKILYCQAMLIYPPSQVGEIALFPSQIALAAIIEAGEKAGLDLFESVISA
VLNNNS
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgtatcacactagtacacaacgaaaatattggacatttcccaacgaagaggaaattgcc
caacataaaggcgctctacataaccaattctttcaaaaattaaaggatgatgattctaga
catatacgtaccaaagatttgcccagtgtagaagaactagatcatctttgcaccttttat
gaattcgaattaatggatctctgcaggcgttttgacccaccaatgcctgctacagctgca
gtgtatatgaagagattttatcttgtctgttccgtgatggactatcacccatgtgatatc
atgttggcatgcgtctaccttgctacgaaggtcgacgagtataatatttctatagataag
tttttgacaatggttcctgaaaacgataaggaacgagccaaaagtcgtacgcttggattc
gagctattagtaatggaaaaattgaaatttcatctgacaatacattgtccgtatagacca
gtggaaggtttattaatcaacattatgacggtgattccagaaattgccgataaaatagac
gagcttagaaggcatatcgataaatttttatcgaagatactgtattgtcaagcaatgttg
atctatcccccatctcaggtcggtgaaattgctttattcccttcacagattgcacttgcg
gcaataattgaagctggtgaaaaagcaggactggacttattcgagtctgttatatctgca
gtattaaataacaattcctaa

DBGET integrated database retrieval system