KEGG   Trichoplax adhaerens: TRIADDRAFT_53799Help
Entry
TRIADDRAFT_53799  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K09583  
protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
tad  Trichoplax adhaerens
Brite
Enzymes [BR:tad01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     TRIADDRAFT_53799
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 794 aa AA seqDB search
MRAFLAICILICGCYLLQTSLAAKKKKSDKGHVIQIDNVKEYKKLLRTRKNILIAFFKTG
GDIGKKLDTLIRAANQVYGIGTLSYVDCGSDKKLCKKLKIKFKKDDLIINHYENGKWHKE
YDRAFVVRSLVNFMNDPHHDAPWEEDPTAKDVLHLSSEKSLQNVLSTKKKPVMVMFYAPW
CRYCKMFKPRFAEVAKTLKHDAIMAGIDSDSPANYGLISRFNIVSYPTLIYFNPKLIEPE
KPEEEESWKDSSLDVVHLADDTFEAFITNHSSVLVDGTLVAVDANENNALSEKYSIKGFP
TADEIVEFMKDPQEPMQVEQLDQEWSLFNKFMAMLNDDDYKDTLKKIKYSLVMFYTPGCE
QSKKAIGDYLAASMTVSGPKYRLFAVNCNEAEKMCQEYNIQGYPSFLYFKHGKKPKSYEG
DQTRTGFVGLMKSLGYKPEERPNEVKSNDDQQTESNEVENKAEVLEAGTDVAARNEKDED
TPASKSGSSLSDNAASSSDENNEQDKDFKEEKLKNEEINKINDGSDIKSGQAKTVVSADL
PVDGSQVNKDSSLSPKDDESRLDNTTDKAEDRKEKEQPNSDDKENEDSMNDEIDHKEEEK
TEASNDNGKQKKPAITIFGYEQEYWLPKIFHDKFDSFIKMHNRLLIVFLSSSPEDHIKGV
TLDSVARKVNKFAIDNKRPYMLAVVDCVDDYDFCLQKEVEKLPTAIYYHNGKPIVRYTGK
RTPEALVDFLESPPTKSKPLGEQKVYRMDREEFLDYMDDVKIRELNMPSIDKLEEIVDLS
RAELQRIMLKHDEL
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atgagagcatttttagccatttgcatcctaatatgtggatgctatctacttcagactagt
cttgcagcgaaaaagaaaaaatcagataaaggtcatgttattcaaatcgataatgtgaag
gaatacaagaagctactgcgtacgcgtaagaatatcttgatagcatttttcaaaacaggt
ggagatattggtaaaaaattagatacactaatacgagctgcaaatcaggtctatggtatt
ggaacgctttcatatgttgactgcggatcggataagaagttatgtaaaaaattaaaaatt
aaattcaaaaaggacgatttaattatcaaccattatgaaaacggcaaatggcataaagaa
tatgatagagcgttcgttgtgcggtcattagttaattttatgaatgatccacatcacgac
gctccttgggaagaagatccaactgcaaaagatgtccttcatttatctagtgaaaagagc
ttacaaaatgtattaagtacaaaaaagaagccggtgatggtcatgttttatgctccgtgg
tgccgctattgtaagatgttcaaacctcgttttgccgaggttgcgaagacattgaagcat
gatgcaataatggcaggaattgacagtgattctcccgctaattatggcttgattagtaga
tttaatattgtcagttacccaacccttatctacttcaatccaaaattgattgagcctgaa
aagccagaggaagaagaaagctggaaggattcaagtttggatgtcgtacatcttgctgac
gacacattcgaagctttcatcactaaccattcatcggttctggtggacggtactttggta
gctgtcgatgccaacgagaataatgcgttgtctgaaaaatattcaataaaaggatttcca
acagctgatgagattgtcgaatttatgaaagaccctcaagagcctatgcaagttgaacag
cttgatcaagaatggagcctgttcaataaatttatggctatgctaaatgatgatgattat
aaagatacgttaaagaaaataaagtattctttggtcatgttttatactcctggatgtgaa
caatcaaaaaaagcaattggggattatctagcagcttccatgactgtcagtggacctaag
tacagattatttgctgttaattgcaatgaagcagaaaaaatgtgtcaagaatacaacatt
caaggttatccgtcattcttatattttaaacatggcaaaaagcctaaatcatacgaaggc
gatcaaacgcgaactggctttgttggcttaatgaaaagtctcggttataaaccagaagag
cgtccaaatgaagttaaaagtaatgatgaccagcagactgaatctaacgaagtggaaaac
aaggcagaggttttggaggcaggaacagacgtcgcagctagaaatgagaaagatgaggat
acacccgctagtaaatcaggatcttcgttatctgacaatgcggctagttcatccgatgaa
aataatgaacaagataaagattttaaagaggagaaactgaagaatgaagaaataaacaaa
attaatgatggttctgatatcaaatcgggacaggcgaaaaccgtcgtaagtgctgatcta
ccggtagatggaagccaagtaaacaaggattcaagtttatcaccaaaagacgatgaatct
agactagacaacacgactgataaagcagaggatagaaaagaaaaggaacaaccaaatagt
gatgataaagagaatgaagatagtatgaacgatgaaatagatcataaagaagaagaaaaa
acggaagcaagcaatgataatggaaagcaaaaaaagccagcaataacaatatttggctat
gagcaggagtattggcttcctaaaatttttcacgataaatttgattccttcattaaaatg
cataaccgtttactaatcgtatttctatcctcttctccagaggatcatattaaaggcgtc
actctggattctgttgctagaaaagttaataaattcgctattgacaacaagagaccttat
atgcttgcagtagtagactgtgttgatgattatgatttctgcttgcaaaaagaggtagaa
aagcttccgacagccatctattatcataatggtaaaccaattgttcgatataccggaaaa
agaacacctgaagctttagtcgattttctggaaagtccaccaacaaaaagtaaacctctt
ggtgaacaaaaagtatacagaatggatcgagaagaatttctagattacatggatgacgtt
aagattcgtgaattaaatatgcctagtattgataaattggaagaaatagtagatctatcg
agagcagaattacaaagaattatgctcaaacatgatgagttataa

DBGET integrated database retrieval system