KEGG   Trichoplax adhaerens: TRIADDRAFT_54134Help
Entry
TRIADDRAFT_54134  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
tad  Trichoplax adhaerens
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TRIADDRAFT_54134
Enzymes [BR:tad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     TRIADDRAFT_54134
Exosome [BR:tad04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TRIADDRAFT_54134
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 524 aa AA seqDB search
MKSLIGVAILFMLLAIANAQDTKTQVNNPWFTEGIKMLEEKLNYKPIKKAGNSVILFIGD
GMSLTTVTAARIYQGQRDGKSGEEGQLSWEHYPHTGLAKTYNIDYQVPDSAGTATAYLCG
VKTNKGLVGVTEKAKRGNCPSAKGTDVYSILTLAQKAGLSVGVVSTARITHATPAVTYAH
TPEREWEGSVPAEVASEGCIDVAQQYINYQREHGGVNVMLGGGRRYFMSESQSDVEYSDL
KGRRKDGKNLLDEWKKLNLPNSHYIWNTSAFNAVDPMKTDYLFGLFEYGHMQYEVNRNKG
PGGEPSIAEMTRKAIQILRRNPKGYFLMVEAGRIDHGHHEGSAYRALVETVAMADAVDVA
NKMTNPNETLVVVTADHGHTMSMGGYQKRGNPIFGLTDDLDIYGNKYLTLNYANGPGGWD
ERKPRPRLTNEMTKDPHFLQQAVAKLVKETHDGTDVAVYAKGPFAHLYAGVWEQSFVVQP
MMKALCLDASKPGQQHCKNSAGGIAPAAMLTLVMALFVTFFQNF
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctctcataggagtagcaatactcttcatgttattagcgattgctaatgcccaa
gatactaaaactcaggttaacaatccatggtttaccgagggcatcaaaatgttagaagag
aaattgaattacaaacctatcaagaaagcaggcaatagtgtaattttgtttataggagat
ggaatgagcttaacaacagttacagcggcaaggatatatcaaggtcaacgcgatggtaag
tctggtgaagaaggacaattgagttgggaacattatccacataccggattagctaaaaca
tataacatcgattatcaggttcccgattctgcggggactgctaccgcatatctatgtgga
gtaaaaaccaataaagggctagttggtgttacagaaaaggctaaacgaggcaactgtcct
tctgcaaaaggaactgatgtttattcaatcctaactttagctcagaaagctggtttatcg
gttggtgtagtatctacagcacgtataacccatgcaacacctgcagtgacttatgctcat
acaccagaacgagaatgggaaggtagtgttccagcagaagtagcatcagaaggttgtatc
gatgttgcacaacagtatatcaattatcagcgagaacatggcggtgttaatgtcatgttg
ggtggaggaagaagatattttatgtccgagtcccaaagtgatgtagaatattcagacttg
aaaggtcgtcgtaaggatggtaaaaatttgcttgatgaatggaaaaaattaaatctacct
aattcacactatatatggaatacatcagcatttaatgctgttgatccaatgaaaactgat
tacctgtttggattatttgaatatgggcatatgcaatatgaagttaatcgaaataaagga
cctggtggcgaaccttctattgctgaaatgactaggaaagctatccaaatattacggaga
aatcctaaaggttacttcttaatggtcgaagctggtaggattgatcatggccatcatgaa
ggtagtgcatacagagcactggttgaaacagttgctatggcggatgctgttgatgtggct
aacaaaatgaccaatcctaatgaaacattagtcgtagttacagccgatcatggccacact
atgtctatgggaggctatcagaaacgtggtaatccaatatttggcttaactgatgattta
gatatctacggtaataaatatttaacgctgaattacgctaacggacctggcggttgggat
gaaaggaagccaagacctcgattgactaatgaaatgacaaaagatccccatttcttacag
caagcagtagctaagttagtcaaggaaactcacgatggtactgatgttgctgtctatgct
aaaggtccctttgcgcacttatatgctggtgtatgggaacaaagctttgtagtccaacca
atgatgaaagcattatgtttagatgcatctaaaccaggtcaacagcattgcaagaattcc
gctggaggtattgctcccgctgccatgctaacgttggtaatggctctattcgtaacattc
tttcaaaatttttaa

DBGET integrated database retrieval system