KEGG   Trichoplax adhaerens: TRIADDRAFT_54143Help
Entry
TRIADDRAFT_54143  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
tad  Trichoplax adhaerens
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TRIADDRAFT_54143
   00053 Ascorbate and aldarate metabolism
    TRIADDRAFT_54143
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    TRIADDRAFT_54143
   00860 Porphyrin and chlorophyll metabolism
    TRIADDRAFT_54143
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    TRIADDRAFT_54143
   00982 Drug metabolism - cytochrome P450
    TRIADDRAFT_54143
   00983 Drug metabolism - other enzymes
    TRIADDRAFT_54143
Enzymes [BR:tad01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     TRIADDRAFT_54143
Glycosyltransferases [BR:tad01003]
 Others
  Hydrophobic molecule
   TRIADDRAFT_54143
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 473 aa AA seqDB search
MGGSHVLTMDIITQQLIERGHETVTIISNQPGQLRKMKPSPTVLYNVENPIIAGQRAANV
TKLSLIGLVQSLFEIQRQYCEATLANDTLVRLLDDVDIFVTDSLYICGVLVPEMLQKPNI
IISLGADIIGYHTFLADYADSTYIPMLGFFHSTKLTMIQRAFNAAIKQFLLITYSYMSSN
LMNSLRYKFNISTQSSHYRIKRNPSLFLAACDFALEYPRPLPPNIKVIGPLSPRPSSSLS
KELEDYMQASDNGIIVLSLGTELQLPKVKATEMLKALAQIPYRVLWKGNQPEETISDNVK
VIKWMPQNDILGHNKTVGFITHCGANGLYEAAYHGVPMIGMPSMIEQKGNAGRMVSAGIG
VLINYHQFQAKDIVKAVQEITTNGRYKENVMKVSRILKSRPRAPRDVVVDWVEYVANTNG
AHHLKVKGEELWLYEYYNLDVCLFIAMIMYFIYLMMRVCKNMMLGKQSKLKDD
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgggtggaagtcatgttctaactatggatatcatcacacaacagttgattgagagagga
catgagactgtaaccatcatctccaatcaacccggtcagctccgaaaaatgaaaccatct
ccaaccgttttatacaacgttgagaacccaattattgcaggccaaagagcagccaatgtt
acaaaattatctctaattggcttagttcaaagtctattcgaaatacaacgacagtattgt
gaagctaccttagctaacgatacactagtccggttgctagacgatgtcgacattttcgta
actgatagcttatatatctgcggcgtactagtaccagaaatgcttcaaaagcctaatata
atcatatcccttggagcagatattattggttatcatacattcttagcagattatgctgat
tcaacttatatcccaatgctgggttttttccattctacaaagttaactatgattcaacgg
gcctttaatgcagccattaaacaattcttactaattacttattcatacatgtcatcgaat
ttaatgaatagtttacgatacaagttcaacattagcacacagtcaagtcattatagaata
aaaagaaatccatcgctttttctagctgcatgtgattttgctttagaatatccgagacca
ttaccaccgaatatcaaagttattgggccattatctcctcgaccttcatcatcattatct
aaagaacttgaagattatatgcaagcttctgataatggtatcatcgtattatcattaggc
acggaattacaactgcctaaagttaaagctacagaaatgttgaaagctttagcacaaata
ccatatcgtgtgttgtggaaaggtaatcaacccgaagaaacaatttcagataacgtaaaa
gtaatcaaatggatgccacaaaatgatatccttggccacaacaagacggttggatttatc
acacattgtggagcaaacggtttatatgaagctgcttatcatggagtcccaatgattgga
atgccctcaatgattgaacaaaaaggaaacgcaggtagaatggttagtgcaggtatcggc
gtacttattaactatcatcaatttcaagcgaaggatatagtgaaggctgttcaagaaata
actaccaatggaagatacaaagaaaatgttatgaaggtttcacgtattttgaaaagcagg
ccaagagctccgcgagatgttgtcgttgattgggtcgaatatgtcgctaatactaatgga
gcacatcatttaaaagttaagggtgaagaactctggctgtatgagtattataatctagat
gtgtgcttgtttatcgcaatgataatgtattttatatatcttatgatgagagtgtgcaaa
aatatgatgttgggaaagcaatccaagttgaaagatgactaa

DBGET integrated database retrieval system