KEGG   Trichoplax adhaerens: TRIADDRAFT_54369Help
Entry
TRIADDRAFT_54369  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
tad  Trichoplax adhaerens
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:tad03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 225 aa AA seqDB search
MSNWDDEDFEPPKAVTKNEWDDEDADNDNVKDNWDDEEEQKAKNDSAETKTTATAPPKKK
KSLKERIAEKEKERMERRKAAQEAAKELTEEEKTAKKLEDQQAVEDADMENIQDTFGINK
KNIYNMNPKTTSEFSEFAEAIVERLTIHEKSPHYPTVLEYIYRNCCLEVDPDEIKKLASS
LNAVASEKLKIQKAKTKKGKKKGGVSKESNTLYEDTVYDEYDDFM
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgtccaattgggatgatgaagattttgaaccaccaaaagctgtgaccaaaaatgaatgg
gacgacgaagacgctgataatgacaatgtaaaggacaattgggacgatgaagaggaacaa
aaagccaaaaatgactccgcagagacaaaaactacagcgactgctccacctaaaaagaag
aaaagtctaaaggaaagaatcgctgagaaggaaaaagagcgaatggaaaggagaaaagct
gcgcaagaagccgctaaagagttaactgaagaggagaaaacggccaaaaaattagaagat
caacaagctgtggaagatgcagacatggaaaatatccaagatacatttggtatcaacaag
aagaacatttataatatgaatccaaaaacaacttcggaattttcagaatttgctgaagca
atagtagaaagactaacgatacatgagaaatcgccacattatccaaccgttttggaatat
atttacagaaattgttgcctcgaagtcgatccggatgaaattaaaaaattagctagttca
ttgaatgcagtagcatccgaaaaattaaaaattcaaaaggctaaaactaagaaaggaaaa
aagaaaggtggtgtttctaaagagtcaaatactctttacgaagatacagtatatgacgaa
tatgatgattttatgtaa

DBGET integrated database retrieval system