KEGG   Trichoplax adhaerens: TRIADDRAFT_54724Help
Entry
TRIADDRAFT_54724  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
tad  Trichoplax adhaerens
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TRIADDRAFT_54724
   00053 Ascorbate and aldarate metabolism
    TRIADDRAFT_54724
   00500 Starch and sucrose metabolism
    TRIADDRAFT_54724
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    TRIADDRAFT_54724
   00860 Porphyrin and chlorophyll metabolism
    TRIADDRAFT_54724
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    TRIADDRAFT_54724
   00982 Drug metabolism - cytochrome P450
    TRIADDRAFT_54724
   00983 Drug metabolism - other enzymes
    TRIADDRAFT_54724
Enzymes [BR:tad01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     TRIADDRAFT_54724
Glycosyltransferases [BR:tad01003]
 Others
  Hydrophobic molecule
   TRIADDRAFT_54724
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 510 aa AA seqDB search
MPDNQPIRHFFNNKPSILLILLIFALPCISSLKVAILPFIAGSHPLSADIIAQHLIKRGH
TPITIISNEPKVLKKLKTSAFALYDIERPFTQTELQKVFTTTNPFIALSYVSDIQTRYCD
AMLSNQTLIQSLQDVDVIVADDLLVCSLLLKEVLNKPSVHVSTSGSIVGFHTFLGAYTPY
SYVPLIGPFSKDMSFLQRAMNVIVGLGMEAIIKNWSSKMLNTLRFKHNIATNLTLFELRR
KFSVYLATLDFAIEYPVPIPPNIHTVGPLTPVPPSPLPQSFEIFMQNSGDQGVIILSLGS
ELQIQDHKLTEMVAALSQLPHQIIWKTKQRIKHVPENVKIVEWMPQNDLLGHNKTIAFIT
HCGSNGVYEGAYHGVPMIGMPAMEEQMGNIRRIIRTEIGVHVDFYKFTMSDITSAVTEIT
ANKRYRENAKRISKILKSSPRTARDAIVDWIEYVVQAEGAHHLKVEGEKLWFYELYNLDV
MLFVLIVLYIIYRMLKACTKMIFQSKAKVD
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacaaccagccgatccgacatttctttaacaacaagcccagcatattacttatt
ctattaatctttgcattgccatgtatatcgtcgttaaaagtcgctatattgccgtttatt
gctggcagccatcctttatcggcggatatcattgcgcaacatctgattaaaagaggtcat
acgcctattactattatttcaaatgagcctaaagtccttaagaaattaaagacttctgct
tttgccttatatgacattgaaagaccctttactcagactgaacttcaaaaagtatttact
accactaatccatttatagcactaagttatgtcagtgatatacaaacacgatattgtgat
gcaatgctatcgaatcaaacgttaatccaatcacttcaagatgtcgatgttattgtcgcc
gatgatttacttgtatgtagtcttcttttaaaggaggtattaaacaagccgtcggtacac
gtttcaacctcaggaagcatcgttggctttcatacctttctgggagcttatacaccttat
tcatatgtacctctgataggaccgttttcaaaggatatgagtttcttacaaagagcaatg
aacgttatcgttggtttaggaatggaagctataataaaaaattggtcctctaaaatgctt
aatacgttaagatttaagcataatattgctacaaacttaacattatttgagttacgtaga
aaattttctgtttatttagcaactcttgactttgctatcgaatatcccgtacctatacca
ccaaatattcacactgtaggaccgctaacacccgtaccaccctcgccattacctcaatca
tttgaaatatttatgcaaaattccggcgatcaaggtgttataattctgtcgttaggtagt
gaacttcagattcaagatcataaattaacggaaatggtagcagctctaagtcaattacct
catcaaattatatggaaaacgaagcaaagaattaaacatgtacctgaaaatgtaaaaatt
gtcgaatggatgcctcaaaatgatcttcttggtcataacaaaactattgcctttatcact
cattgtggttcaaatggcgtgtacgaaggggcctatcatggtgtacctatgataggaatg
ccggctatggaagagcaaatgggtaatattcgcagaataattcgcaccgaaattggagtt
catgtagacttttacaaattcacaatgagcgatattacaagtgcagttactgaaatcact
gccaataaaagatacagagaaaacgccaaaagaatatctaaaattctcaaaagctcgcca
agaacggcaagagatgctattgtcgactggattgaatacgttgtgcaagcggaaggagct
catcatctaaaagtagaaggagagaaattgtggttctacgaactatacaacctagatgtt
atgctattcgtactaattgtactctatattatctatcgaatgttgaaagcttgtacgaaa
atgatatttcaatcaaaagctaaagtagattag

DBGET integrated database retrieval system