KEGG   Trichoplax adhaerens: TRIADDRAFT_54771Help
Entry
TRIADDRAFT_54771  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
tad  Trichoplax adhaerens
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TRIADDRAFT_54771
Enzymes [BR:tad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     TRIADDRAFT_54771
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 437 aa AA seqDB search
MVAKMSDLKFLTKVIFIPTMLILGVSGGQTSDYYNQSVISTVAFGSCSKNSLPQTIWQSV
IGQKPDLFVWLGDVVYADRRILPFVWTRNPPEVVEDIYMRFYNNTAYKKFRNSGIKIVGV
WDDHDYGENGGNKNSNNKLQTQHVFLNFLDEPPDSKRRQREGIYVSYYFGTGNKTVKLIL
LDTRTFFDPINEDILGNEQWKWLKEQLSEDAALTIIGSSIQVLTDIPFVDRWRFYKKSFD
RFLWLIRSRPRVILLSGDVHFGEISCLNESWIGYPIFDITSSGLTHTCETTLVPFSVCSW
SLKRYVISKYRVGDIHLNQNFGLIRLKWNEQATEISIEIHGLDGLSLQQTVKLSDLDSKS
TPASCPTRVARPTNNMKYAVYAFTFCALAIPLVLLVLIIRSTNKIFKRMFPPSEPANNCS
NPIDKAVYHTHNRLKAE
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggtagcgaaaatgagcgatttaaagttcttgaccaaggtgatcttcatacctactatg
ctgatacttggtgtaagtggaggtcaaacttccgattactacaatcaaagtgttatcagt
actgtcgcctttggcagctgcagcaagaatagtttaccacaaacaatttggcaaagtgtt
attggacaaaagccagatttattcgtttggctaggtgatgtggtctacgcggatcgcaga
attctaccatttgtatggactcgtaatccaccagaagttgtagaagatatctatatgcgc
ttctataacaatactgcatacaagaaatttcgaaacagcggtataaaaatagttggcgtt
tgggacgatcatgattatggtgaaaatggtggtaataagaattccaataacaaattgcaa
acacaacacgtatttttaaattttttggacgaaccaccagatagcaaacgtcgccaaaga
gaaggcatttacgtctcttattattttggaactggtaacaaaactgtgaagctaatttta
cttgatacaagaacgttctttgatcctattaatgaagacatacttggcaatgaacaatgg
aaatggttgaaagagcaactaagtgaagacgcagctttaactataataggcagtagcata
caggttttaacggatattcccttcgtcgatagatggagattttataaaaaaagttttgat
agatttctatggttaatcagatcaagaccaagggtcatcttgctaagcggcgatgttcac
tttggagaaatttcatgtctcaacgagtcatggattggatatcctatattcgatattact
tccagcggactaacgcatacatgtgaaacaactcttgttccatttagcgtctgcagctgg
tcgttaaagagatatgtcatatctaagtatcgagtcggtgatatacatctaaatcaaaat
ttcggattgatacgtctgaaatggaatgaacaagcgactgaaatttcaatcgaaatacat
ggattagatggcctaagcttgcagcaaacagttaaattaagcgacttagattcgaaaagt
actccagcaagctgtccaacaagagtagcgaggcctacgaataatatgaagtatgccgtt
tacgcgtttactttttgcgcacttgccatacccttggtattattagtacttattatcagg
tcaactaataaaatatttaagagaatgtttccgccttcagaacccgcaaataactgttct
aatcctatagacaaagccgtttatcatacgcataacagattaaaagctgaataa

DBGET integrated database retrieval system