KEGG   Trichoplax adhaerens: TRIADDRAFT_55881Help
Entry
TRIADDRAFT_55881  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
tad  Trichoplax adhaerens
Brite
Enzymes [BR:tad01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TRIADDRAFT_55881
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 454 aa AA seqDB search
MVKTTLTSSTNENDGGNSVDGSTSRGENKENNDNLSNDIGSRRFEKPIQVADKCMARRID
DTWQLAEIIHIRPSLTDDTGSRYYVHYVGYDRRLDEWLGIDRLKPASVKETNEASIRPDI
WSLAENQERKVTRNQKRKHDEINHIQKTYAEMDPTTAALEKEHEAITKVKYIDKVQIGKY
EIDAWYYSPFPDEYGKQSKIWICEYCLKYMKYESTFKHHLTICNHKQPPGGEIYRKCSLS
VFEVDGKNHKLYCQNMCLLAKLFLDHKTLYFDVEPFLFYQLTEVDEDGCHLVGYFSKEKE
SADGNNLACLLILPPHQRKGYGKFLIALSYELAKMERKIGSPEKPLSDLGKLTYRSYWSW
VLLEALKDFRGTLTVRDLCQMTCITEEDIIGTLQSLNMTKYWKGQHVICVTPKQIEELLS
SPEYRKPQITLDTRYLRWSSQKYSQPLKTPQKSK
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaaacaacgcttaccagtagtactaacgaaaacgatggaggcaattccgtcgat
ggatcaacatcaaggggagaaaataaagaaaacaacgacaatcttagcaatgatatcggt
tctagacgattcgaaaagcccattcaagtggcagataaatgtatggccagacgaattgat
gacacgtggcaactagcagaaatcatacatatccgaccctcattaacagatgatactggc
tcacgctattacgtacactacgttggctatgatcggcgtttggatgagtggctaggaata
gatcgccttaagcctgcgagcgtaaaagaaaccaatgaagccagcatcagaccagatatt
tggtcactagctgaaaatcaggagcgcaaagttacccgtaatcaaaagcgtaaacatgat
gaaattaatcacatacaaaagacttacgctgagatggacccaacaacggccgctttagag
aaggaacatgaagcgattaccaaggtcaagtacattgacaaagttcaaattggaaagtac
gaaattgatgcttggtattattctccctttccggatgaatatggtaaacagtcaaaaatt
tggatctgtgaatattgcttgaagtacatgaaatatgaaagcacattcaaacatcatttg
acaatatgtaatcacaagcaaccacctggtggagagatttatcgcaaatgctccttatct
gtttttgaagttgatggaaagaatcacaaactttactgtcaaaacatgtgtttactagcg
aagttgttccttgatcataaaactttatatttcgatgtggaacctttcttgttttaccag
ctaactgaggtagacgaagatgggtgccaccttgtaggatatttttctaaggagaaggag
tctgctgatggtaacaatttagcgtgcctattaatcttaccgccacatcaacgtaaaggc
tatggaaaatttttaatagctctaagttatgagctcgctaaaatggaacgaaagattggc
tcgccggagaaacctctatccgatttaggaaagctgacgtaccgaagttattggtcatgg
gtattgctagaggcattaaaagattttagaggaacgctgaccgttcgagacttgtgtcaa
atgacatgcattactgaagaagatattattggtaccctacaatcgctaaatatgactaaa
tattggaaagggcaacatgtaatctgtgtaactccgaagcagattgaggaattgctatca
agcccggagtaccgaaaacctcaaataactcttgatactagatacttacgatggtcctca
cagaagtattctcaacctcttaaaacaccgcaaaaatctaaataa

DBGET integrated database retrieval system