KEGG   Trichoplax adhaerens: TRIADDRAFT_57462Help
Entry
TRIADDRAFT_57462  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
tad  Trichoplax adhaerens
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:tad00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    TRIADDRAFT_57462
Protein kinases [BR:tad01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   TRIADDRAFT_57462
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 2534 aa AA seqDB search
MADKFIVGLKSRSDEVRLRAAKELQRSITTELREVSNEEYQSFWDELNHQIFELVSSSDV
HEKKGGILAIISLIGVDGGNAPTKISRFANYLRNLLPSSDPSVMDMASKAVGLLALAGGT
FTAEYVEFEVKRALEWLSGERHEGRRLAAVLVLRELAVNAPTFFYQQVQSFFDNIFSAVR
DPKQSIREAAVEALQACFVLTSQRETSSDHYPVWYQSAYDEAWRGFRDPGSGKEKGVTLS
RDDKMHGSLLIINELLRASSSEGERLRREMEEIMVQQSTAGVVIRQHPSIQKSAMYGSPG
QQALNSGRFLDLFDSENSTSIDSKLRNRIVGFCQSQFCRTFMLTKFPEISVQIMKSFRNH
RNSLIQQTLLIILPRLSAFQPQKFVDTLLDDAINHLLSCLRKDKERSSAFLALGLLAVAV
KKDIKPYITKIFENIKAALPPKEVGHKRHKVVTVDPSVFICISMLGRALGVEIKRDIREL
IDPMLSVGISSSLVASLRDISVQIPPLKNDIQEGLLKILSVVLMHKPLHHPGMPKSMIPA
LSKSDDVSDVTTITLAIRCLVNFDFEGKSLTEFIKYCAENYLFNDNRIIRIEAVRTCSQL
LKPIPHPLVLGQQYDVVSTNSMHLVNEILMKLLTVGITDPGKRVQMMKPFGFIICNVTFE
IMQLNDKKLSVDPDTRYCVMSSLDEKFDTYLAQAENLQMLFIAINDEVFEIRELALCHIG
RLSSLNPAYIMPSLRKTLMQILTELKFSGLGRNKEQSARLLSLLISNAPRLTRPYVKPII
NTLLPKLKENDPNPAVVVNVLSAVGEQAQVSGEELIEWIEDLFPIILDILQDSSSSSLNK
REVALRTMGQVVESTGYVVEPYSRYPNLLETLLSFLKTEQSKSIRRETVRVLGLLGALDP
YKHKVDRMKRSSDIYNVQDVLIPETKGLADPSSIGELNVTEMLVSMSSVQMDEFYPAVAI
AALMRILKDSSLSSHHSMVVQAFSFIIKSLKIKCVAFLPQIVPTFLNVARSCDTTLKESL
LQKLGVLISLAKQHIRNYLVDIFQLIQECWTVNNPMQNTIIALLEQMAIALGSEFKVYLP
QIIPQILKTFIHDNSHNQIVTNKLLIALQSFGSNLDDYLHLLLPPIVKLFDSSNQDISLT
VRKTSLETIDKLIESLDFTDYASRLIHPIIRAIDTLPEVRSSAMDVLCSLASQFNGKYKI
FISMVNKVLQKHRIQHLKYESVVSKVLKSSHTVDSESVFSARPRRSTTLMSEMATTNNTE
NNTIKKLYVSADNLKRAWEPGRRVNKDDWTEWLRRLSVELLKESPSPALRSCWSLAQAYS
PLARDLFNAAFVSCWSELNEEQQNLKQDELVQSIEKALESQNNPEITQALLNLAEFMEHC
DKGPLPLNNNELLGDCALRCRAYAKALHYKEEEFHREPTPKTLETLIGINNKLQQPEAAA
GVLEYAMKNMGAMSVEETWYEELNEWNKALDVYQKKQEQGSDDISITLGHMRCLEALGEW
GQLYNIASERWSIVDDETKQKMARMAAAAAWGLGHWESMEEYSCLIPRETLDGAFYRAVL
ALHQEHRVLAQQCVDTARDILDTELTAMSSESYNRAYGAMVTAQMLSELEEIIQYNLIPE
RRAAIKQIWWSRLQGCQNLVEDWQRILQVRSLVITPQEDMETWLKYASLCRKSKRQALSH
KTLALLLGSDPSKYTDQPLPTKYPKVTFSYMKHMWLSGQQEEAFQHLQYFVQTMITQNAA
VASLSSNEETQQSIKEANNRLLARCYLKLGEWMLSLSQLNEQTITQIIQYYACATEHDKN
WYKAWHSWAFMNFEALLNMKNNEKSQHTIVSDDSKAGVSLQNYAVSAVNGFVRSITLSKG
NSLQDTLRLLTIWFDYGEWKRVNEALVDGLKVIQIDTWLQVIPQLIARIDTPRPAVGKLI
TQLLIDIGKQHPQALIYPVTVSAKSAIAARQEAASRILNNMREHSPVLAQQAVMVSQELI
RVAILWHEMWHESLEEASRLYFGEHNIEAMFAVLEPLHQIMQQGPQTLKETSFNQAYGRD
LAEAQEWCNKYKKSNNGADLTQAWDLYYHVFRRISKQLTQMTSLELQYVSPKLLVCRDLE
LAVPGTYQPNKSIIRIQKVQPSLQVITSKQRPRKLCISGCDGTDYMFLLKGHEDLRQDER
VMQLFGLINTLLTNDPETFKRHLRIQGYSVTPLSTNSGLISWVSPCDTLHALIRDYREKK
KILLNIEHRIMLRMAQDYDHLTLLQKVEVFEHAMEHTQGDDLARVLWLKSPSSEVWFDRR
TNYTRSLAVMSMVGYILGLGDRHPSNLMLHRLSGRVLHIDFGDCFEVAMTREKFPEKIPF
RLTRMLINAMEVTGIEGNYRTTCNSVMEVLRDNKDSVMAVLEAFVYDPLLSWRLVEGAPK
NKRSKGGNPGVLGQADKVLMDDRVWYSLDIADVTYVGQSTAKSFAAQRELKEALDRQNKP
EELNKKAVAIINRVRDKLTGTDFSRHNTLDVPTQVDLLIKQATSHENLCQCYIGWMLDIY
YAVLRMPYMLKKAL
NT seq 7605 nt NT seq  +upstreamnt  +downstreamnt
atggccgataaattcatcgttggattgaaaagtcggagcgatgaagtccgattaagggct
gccaaagaattacaacgctcgataacaacagaattacgtgaagtatccaatgaagaatat
caaagcttttgggatgagttaaatcatcaaatttttgagttagtttcaagtagtgatgtc
cacgagaaaaaaggaggcattttggcaataattagtttaattggtgtggatggaggaaat
gctccaaccaagattagccgatttgctaattacttgcgtaatctattgccatcgagtgat
ccctctgtgatggatatggcttccaaggccgtaggattgttagctttagctggtggcaca
tttactgctgaatatgtcgaatttgaggttaaacgagctttggaatggttatctggtgaa
cgtcatgaaggaaggcgcttagcagcggttctagttttgcgtgaattagcggtgaatgct
cccacttttttctatcagcaagtccaatcattttttgataatatctttagtgcagtccga
gaccctaagcaatctattcgagaggcagctgtagaagccttgcaagcttgctttgtactt
acatctcaaagagaaacaagttcagaccactaccctgtatggtatcagtctgcgtatgac
gaagcctggcgtggatttcgtgatcctggctctggtaaagaaaaaggcgttactctgagc
cgagatgataaaatgcatggttcgttgttaatcattaacgaattgttaagagcaagtagt
agcgaaggagagcgattgcgacgtgaaatggaagaaattatggtacaacaatcaacagct
ggtgttgttatacgacagcatccaagcatacaaaagtctgcaatgtatggcagccctggt
cagcaggcattaaattccggccgatttcttgatttatttgattctgagaatagtactagt
attgattctaagttacgaaatcgcatcgtcggtttctgtcaaagtcaattttgtcggaca
ttcatgcttaccaaattccctgagatttctgtccaaatcatgaaatcttttcgaaatcat
cgcaacagcctgattcagcaaacactactgattattttacctcgattgtctgcgttccag
ccgcaaaaatttgttgatacactcttggatgatgccatcaatcacttactgagttgtcta
aggaaggacaaggaaagatcttccgcttttctagctcttggattattagctgtcgctgta
aagaaagatattaagccatatattacaaaaatttttgagaatattaaagctgctttgccg
cccaaggaagtcggacacaagcgccacaaagtcgttacagttgatccatcagtcttcatt
tgtataagtatgctagggcgcgctcttggtgtagagatcaaacgggacattcgagaactg
atcgatccaatgttatcggtcggcattagctctagtctcgttgcctctttacgggatatc
tcagttcaaattcctcctttaaaaaacgatatacaagaaggtttacttaaaatcttatcg
gtcgtactaatgcataagcctttgcatcatcctggtatgcccaaaagtatgattccggct
ctatcaaagtccgatgacgtctctgatgtaactaccattactctcgctatacgttgcctt
gttaatttcgactttgaaggaaagtctcttacagaatttatcaagtattgcgcagagaat
tatttatttaatgacaatagaattattagaatagaggcagtgcggacatgctctcaatta
ttaaaaccaataccgcaccctcttgttcttggccagcagtatgacgtcgttagtacaaat
tcaatgcatttagttaatgaaatattaatgaaattacttacggttggaataacagacccg
ggtaagcgagtgcaaatgatgaagccatttggatttataatttgtaatgtaacgtttgaa
attatgcaactaaatgataagaaattgtctgtagatcccgacactcgatattgtgttatg
tcatcgttggacgaaaaatttgatacctatttggcccaggctgaaaatttgcaaatgctt
ttcattgctattaatgatgaggtattcgagattagagagctagcgttatgccatattgga
cgtttaagtagtcttaatccagcgtacattatgccatccttgcgaaagactctaatgcag
atattaacagagcttaaatttagtggacttggtcgcaataaggaacaaagtgctcgcctg
ttaagtctcttaatatcgaatgctcctcgcctaaccagaccatacgtcaagccaattata
aataccttattacccaagctcaaagaaaatgatcctaacccagctgttgttgtcaatgtc
ttatcagcagtaggcgagcaagcacaggtcagtggagaagaattaatagaatggatagaa
gacttgttccctattattttggatatactgcaggattcctccagttcttctctaaacaaa
cgtgaagttgctttgcgtaccatgggtcaggttgtcgaaagtactggatatgttgtcgaa
ccctatagtcgatatccgaacttattggagactttgcttagctttctgaagacagagcag
agtaagagtatacggagagaaactgttagagtattaggtcttttgggagctctcgatcct
tataaacacaaggttgatcgaatgaaaagatcgagcgatatttacaatgttcaagatgtt
ctcattccggaaactaaaggattagcagatccttccagtatcggtgaattaaatgtgaca
gagatgctcgtttcaatgagctctgtgcaaatggatgaattctatccagctgtggcgata
gcggctttaatgagaatccttaaagattcatctctatcgtctcatcatagtatggtagtt
caagccttcagttttatcatcaagagtcttaaaatcaaatgtgtggcttttctaccacag
attgtacctacatttctaaatgttgcgagatcatgtgataccactctgaaggaatctttg
cttcagaagctgggtgtacttatctctcttgctaaacaacacattagaaattacctggta
gatatcttccaattaattcaggaatgttggacagttaataatcctatgcaaaacacgatt
atagctttgctagagcaaatggcaatagctctaggaagtgaatttaaggtttatctgcct
caaattataccgcagatattgaaaacctttattcacgataatagccataatcaaattgtt
acaaataagcttttaattgcattgcaatcatttggtagcaacttagacgactatcttcat
ctactgttaccacctatcgtgaaacttttcgattccagtaatcaagatatatcgttaacc
gtacgaaaaacatcattggaaactatcgataaactaatcgaatcattagacttcaccgat
tatgcgtcgcgcctcattcacccaattatccgtgcaattgataccttgcccgaagtcaga
tcgtctgcgatggacgtcctgtgctctttagcatcacaatttaatggcaaatacaaaata
tttatttctatggtaaacaaggtattgcaaaaacataggatacaacacttaaagtacgaa
agtgttgtcagtaaagttttgaagagttctcatacagttgactctgaatcagtattttcg
gctcgcccgcggcgttcgacaactttaatgtccgaaatggctactactaataatactgag
aacaataccataaaaaagctctatgttagcgctgataacttgaaaagggcctgggaacct
ggaagacgcgttaataaagatgactggacagaatggctaagacggctgagcgttgaattg
ttgaaagaatcaccttctccagcattacgatcttgttggtctttagctcaagcttatagc
ccgcttgctagagacctttttaatgccgcatttgtttcatgttggtctgaattaaatgaa
gaacagcagaatttaaaacaggatgagttagtgcaaagtattgaaaaggctttggagtct
caaaacaatcctgaaattactcaagccttgcttaatcttgccgaattcatggaacattgc
gataagggcccattgccactcaacaataatgagttactaggtgactgtgctttaaggtgt
agagcatatgctaaagctctccattacaaagaggaagagtttcatcgagagccgactccg
aaaacattagagacattgataggtatcaataataaattacaacagccggaagctgccgct
ggagtcttagaatatgcgatgaaaaatatgggtgcaatgtcggtagaagaaacttggtat
gaagagttaaatgaatggaataaggcattagatgtttatcagaaaaagcaggagcagggt
agcgatgatatttcaattacacttgggcacatgaggtgcctagaagctcttggtgaatgg
ggacagttatataatatagcatctgaacgttggtctattgtcgatgacgaaaccaaacaa
aagatggcgcggatggctgcggctgccgcatggggtttaggccattgggagagcatggaa
gagtacagttgtttaataccaagagaaacattagatggtgctttttaccgagcagtgctt
gcccttcatcaagaacatcgcgtgttggcacaacagtgtgttgatactgcacgagatatt
ctcgacactgaattaacggcgatgtccagtgaaagttataatcgtgcctatggagccatg
gtgactgcacaaatgttatcagagttagaggaaattattcaatacaacttgatacctgaa
cgtagagctgctattaagcagatatggtggagtcgtttacagggatgtcaaaatcttgtc
gaagattggcaacgtattcttcaggtccgatcgttggtaataactcctcaagaagatatg
gaaacctggttgaagtatgctagcttgtgccgcaagagtaagcgacaggcgttgtctcat
aagacactagcgctactattaggaagtgatccttccaaatacacggatcagcccttaccg
actaaatatcctaaggttacattttcgtatatgaaacatatgtggctttccggtcaacaa
gaggaagcatttcagcacttacagtactttgtacaaacaatgataacccaaaatgctgca
gtggcatcccttagcagtaatgaagaaactcaacaaagtataaaggaggcaaataaccgt
cttctagcaaggtgttacttgaaactgggtgagtggatgttatccttaagccaattaaat
gaacaaaccattacccaaattatacaatattatgcatgcgctactgaacatgataagaac
tggtacaaggcatggcattcttgggcttttatgaactttgaagcgttgctaaatatgaaa
aataatgagaaatctcagcacacaattgtttcggatgattccaaggccggtgtttcttta
caaaattatgctgtatcggctgtaaatggattcgtaagatctattacactatccaaaggc
aattctctccaagatactcttcgattgctaactatttggttcgactatggtgagtggaaa
agagtgaacgaagccttagtagatggcttgaaagttattcaaatcgacacctggcttcag
gtaataccgcaacttattgcaagaatagatactcctaggccggctgttggtaagctgatc
actcagttgcttattgatattggaaagcaacacccgcaggccttaatttatcctgttact
gtatccgcaaaatcagctatagcagctcgtcaagaagccgctagtaggatccttaataat
atgagggagcacagcccggtactcgctcaacaggctgtcatggttagccaagaattaata
agagttgcaatactatggcatgaaatgtggcacgaatctctagaagaagcttcacgacta
tattttggtgagcataacattgaagccatgtttgccgtattagaacctcttcatcagatt
atgcagcaaggaccacaaacgctgaaggaaacatcattcaatcaggcctatggtcgcgac
ttggctgaagcccaggaatggtgtaacaaatataagaagtcaaataacggtgcagatcta
acacaagcctgggatttgtactatcacgtattcagaagaatctcaaaacaattaacacag
atgacgtctcttgagttgcagtacgtttcacctaagctccttgtctgccgggatctagaa
ttagccgttcctggaacttatcaacctaataaatctatcattagaattcagaaagttcaa
ccatcattgcaagtaataacatctaaacaacgtcctcgaaaactttgcatatcaggctgt
gatggcaccgattacatgttcttgttgaaggggcatgaagatcttcgtcaagatgaacgc
gttatgcagttatttggccttataaatacgttattaacgaacgatccggaaacttttaaa
cgccatttgaggattcagggatactctgttacgccgctgtcgacaaattctggattaata
agttgggtatctccttgtgatacactccatgcgctgattagggattatcgtgaaaagaaa
aaaatcttgttgaatatagaacatagaataatgttacggatggcacaagattatgatcat
ttaactctgcttcagaaagttgaggtatttgagcacgcaatggagcatacgcaaggtgac
gatcttgcaagggtactttggctaaaaagtcctagctcagaggtttggtttgatcgtcga
acaaattatacgcgttctttagctgtgatgtctatggttggatacattttaggtttagga
gataggcatccatccaatctaatgttgcatagactatctggaagggtactacatatcgat
tttggagattgttttgaagttgctatgacacgtgaaaaatttcctgagaaaatccctttt
agattgacccgaatgctaattaatgcaatggaggtaactggaatagaaggaaattatcga
actacttgtaatagtgttatggaagtccttagagataataaggacagtgttatggccgta
ttagaagcttttgtatatgatccactcctaagttggcgactcgtagaaggtgctccaaag
aataaacgttcaaaaggaggaaatccaggtgttcttggccaggcggataaggttttaatg
gatgaccgtgtttggtattctttagatatagctgatgttacctatgttggccaaagtaca
gcaaagtcatttgctgctcaacgggaattgaaagaagctttagatagacaaaataaacca
gaagaattaaataagaaagctgttgccatcatcaacagagtccgtgataaattaactgga
actgatttctcgcgtcataatactctcgatgtacctacacaagtggatttgttgattaag
caagctacgtctcacgaaaatttatgtcaatgttatatagggtggatgttagatatatac
tacgcagttttaaggatgccttatatgctcaaaaaggctttataa

DBGET integrated database retrieval system