KEGG   Trichoplax adhaerens: TRIADDRAFT_57882Help
Entry
TRIADDRAFT_57882  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K11404  
histone deacetylase 3 [EC:3.5.1.98]
Organism
tad  Trichoplax adhaerens
Brite
Enzymes [BR:tad01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     TRIADDRAFT_57882
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 437 aa AA seqDB search
MGPKRDVMYFYDPEVGNFHYGKGHPMKPHRISLTNSLVLSFGLHKKMTMFRSIPASDFNL
CRFHAYDYIEFLKKITPANIREFPYSTLNTYNVGDDCPVFGGLFDFCAMYTGASLQGATK
INHQECDIAINWSGGLHHAKKREASGFCYVNDIVVAILELLKYHARVLYIDIDVHHGDGV
QEAFYLTDRVMTVSFHKYGDQFFPGTGDMYEIGTDRGKYYSINVPLKDGIDDHGYLYVFK
PVIEAVIQHYQPSSIVLQCGADSLGCDRLGCFNLSIKAHGACVQFVKSFNIPTLVLGGGG
YTISNVSRCWCYETALLVDADITNDLPYTEYLEYFAPDFSLHPSISYARAENLNTRQYLD
NIIQSVNDNLKCITSAPAVQMQAVPPDLIDFDSENEDQEQYLSEVDQPPSIEPANEYYDG
DSDNDKDLGVDIETAID
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgggccccaaacgcgatgtcatgtatttctatgatccagaagtgggtaatttccattat
ggcaaaggacatcccatgaaaccgcataggatatctttaaccaacagtttagtcttaagt
tttggattacacaagaaaatgactatgtttcggtctatcccagcttccgatttcaacttg
tgccgttttcatgcatacgattatatagaatttcttaaaaagatcacacccgcaaatata
agagaatttccttatagtaccttgaacacgtacaacgttggcgatgattgtcctgttttt
ggtggcctttttgatttttgtgctatgtatactggagcatcgcttcaaggagcaacgaaa
ataaatcatcaggaatgtgacatcgctattaattggtcagggggattgcaccatgcaaaa
aagagagaagcctctggattctgttatgtcaacgatattgtggttgcaatattggaactg
ctaaagtatcatgcccgagtattatacatcgatatagatgttcatcatggtgatggcgtt
caggaagcgttttatctaactgatcgtgttatgactgtatcttttcacaagtatggagat
caattctttcctggaacaggtgatatgtatgaaattggaactgatagaggaaaatactac
tctattaatgtgccattgaaagatggcattgacgaccatggctatttatatgtttttaag
cccgtcatagaagctgtaattcaacattaccaaccatctagtattgtattacagtgtggt
gctgattctttagggtgtgatcgcttaggttgtttcaatcttagtataaaagctcacgga
gcatgtgttcagtttgttaaaagttttaatattccgaccttggtgctcggtgggggtggt
tatactattagcaatgtatctagatgctggtgctacgagactgctttattggttgatgcc
gacattaccaatgatcttccgtatactgaatatttagaatattttgctcccgatttttca
cttcatccttcgatcagctatgcgagagcggaaaatttaaatactagacagtatctagac
aatatcattcaaagcgttaacgataacttgaaatgtattacctcggcgcccgcggttcaa
atgcaagcggtacctcctgatttaatcgattttgactctgaaaatgaggatcaagaacaa
tatctaagcgaagtagaccaaccaccaagtatcgaaccagctaatgaatactacgatgga
gattctgacaatgataaagatcttggagttgatattgaaactgctatcgattaa

DBGET integrated database retrieval system