KEGG   Trichoplax adhaerens: TRIADDRAFT_59589Help
Entry
TRIADDRAFT_59589  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.1.2.15]
Organism
tad  Trichoplax adhaerens
Brite
Enzymes [BR:tad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     TRIADDRAFT_59589
Peptidases [BR:tad01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TRIADDRAFT_59589
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 2373 aa AA seqDB search
MSSSNTTISTIQSPSGEKQDNTETVDSDEMTKVEITFPIAELNKLEEMINKTRWVVPVLP
GGELLVLLESSIKIGQQSDIFECTDEAHQYCQRFIKDGLVSSFTKILCDDARSIVKNIEK
LVELCVVTFHQDILPLLDLLAVAMNPSSSGSRAEWTQSNCANHCVLDQAIRKLCRFLNGN
YPSELHDAYCGEDHITKLLDKLSDDELKKESKSESKSDAISSIIRALKNLSVRVPGKEEV
IRTVELFRLKIVLRLLQMSSFNGKMSALNEMNRLIMNVSYITHRNTGSSYPDDDWLTADR
IAEWIQQNDVLNVVLRDNLHQPQYVEKLEKILRFAIKEKAVTFRDLDLIWAAQAGKHEAI
VKNVHDLLAKLAWDFSAQQLDYLFDCFQKSWTNASNKQREKLIELIRRLAEDDKEGFMAQ
KVLELLWNLVHDRDVPIEIMDLALSAHIKILDYNCSPDRDVQKTNWIDKCVEELKESNWV
IPAVKHIQEICQLFYEAPRDYSRSQPLSHLFYRHEVINQLQQKHKIVSVTAENLSIYMNK
ARAHFQAFRENSTSDVMPASHYSHSQQVDERLTFLRYCLRDGHLILQLPEAELIWFCLAE
KGIHLSDREACFTWFSRILEDTTVMQPETCQKFFEKNILTFDPSLLTENGVRCFELFFRA
VNGGTKINNETKPIYKHDQELIGVDYIWRVVLCSEEDVANKAIELLKETYITLNPDVQNS
QVLADSEFIETCMKRLQVSCNNLRSFAMTESSSTESQDMIVREATRNVRVLKVIKDYFAD
CDDEFSGDRTILPHGRLRSCGNNRTDLYVNNEILNPADDNKLVCDMPIRDRSIIYAKVNQ
GINSVPSSPDSSSESSSGYPNGHYDGPNIDAEKCLPGVVFAGMENHVKFLFDLADVGAIF
EATDGIVNGVYDLLQRLPSANFITKNVETVCKGIVEQYDEVHDGGMLKNQLGETVSLRSL
YSLEVIYAMLMPAFLPQSESTENFQKSFIKSGGLSYIFSFLRQNISEQSCNRMIQRQLCH
LCLKIGKFLLTVTGHAQVAIVADAVRENGNSSVTPAAHSAALVLQQALQTVPCPQSEFML
INIAAKMGKIMKEKATRYMPSIEDIRLFIKIAWTSAGGLLSCINISIDELQKAFRHGKTS
TVTSCIDEGPVAMEALEVLGVSLALCPSILDTLSREKSWQLFIVDVLSVRICAAEQFLTI
ATKCSPGNRCLLHFLELFFSILTTAVEEFALFSGEYFLLSCRLLNYGHVTKVPVSKAENL
LLNEISWLRNIKEKFKKNNVLGDIDQILLDGHLSVTKELLSFISGQKKSYIGCKYDNISF
IEELMYQFLFPASKLLHDIGSKKDDINWKQVKRICHTPITTNAAMDLLVAFCVGSISNFH
LVCNILSELFNYPEISNALDVWEYSPTVGCRPSNGYVGLKNGGATCYMNSVLQQVCKSVL
NVQTSFEKEEVDAYDGSDKGGDIELNIDPYIREDRQRFQDSRKDMPIKEYNLCLLKQVQS
IFAHLTESLLQYYIPRGFWKMFRLQGNPVNLREQQDAYEFFNSLVDTLDEALKDQGFPPF
LSHVFGGTFADQKICKGCPHRYSRDESFTAISVDIRNHQNMVESLEQYVKGDLLEGVNAY
YCERCDKKVDTVKRMCIKKLPKILAIQLKRFDYDWERDCAVKFNDYFEFPREFDMEPFTV
AGLAKIEDESIEDIETDSEDSPVTQYRLVGMIVHSGQANGGHYYSYIIKRGEDGNGGQWF
KFDDGDVTECRMDDDEELKSQCFGGEYMGEVYDQVVKRMSFRRQKRWWNSYILFYERKDI
VDNDGNMHGFQQAVNIPKQIHGAVIRQNIYFLHEQMHYSYEYFQFIRKLIIANFQHLSRD
NQPPDLEEFGVLSIEMASKFLFSIGFRTKKGIRGSYNDWYDAIALIFRHSRNARIWFARN
VLFAHPQRFTEYLLECPVGEMRYTFAKIIVTLCHLTLIETPTSPLRLSSADNDDEETEYT
HSISDNILKAVLSLINRDLPEHGRYYQQYFQLFLMYANFGMGQRIQLLRLGVADVFMNLS
SDENTGSVLRYQSQDLSKLHAVTSILIRSCDISNKEKQCETMPGNYGENPYTELSPHDHK
KWILPLPREVEMLLFIRKIYLKKILEEYPGNEETAKLIEFCSWENEHFSRLIVSKLLYYI
QHAPSGDRLKPYIDLFVSVLTIEDSWQQQRIHLAMQGISDERLGIFDIIINSRGRHQKRS
YLCMKFLVSFIPSYRVALELFQDNHVWKQKWTEAVNWLGDELDRNTYPTGSGYGYTNWSP
PAQSNETSAGSLLERSNSARVVYAKALELVDEGEYDDIEEIDELNAQNERNKRYHAAPNR
YFPESDDNLAASESTRHENSDEENRGSRRNLGN
NT seq 7122 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcagtaacacaaccattagcactatccaatctccttcaggtgaaaaacaagat
aataccgaaacagttgatagtgatgaaatgacaaaggtagaaatcacatttccaatcgct
gaacttaataaactggaggaaatgataaataaaacacgttgggtagttccagttttaccg
ggtggtgaattactggtgttattagagtcttccattaaaattggccaacaaagtgatata
tttgaatgtacagatgaagcacatcaatattgtcagagatttattaaagatggcctagtt
tcatcctttactaaaattttatgcgatgatgccagatcaattgtgaaaaacattgagaaa
ctggtagaattatgcgttgtaacgtttcatcaagatattttgccgttacttgatttatta
gctgtagcaatgaatccgagctcaagtggatcgcgtgctgaatggacccaatctaactgt
gccaatcattgcgtccttgatcaggccattcggaaattgtgccgatttcttaacggaaac
tacccttcggaattacatgatgcctattgtggtgaggatcatatcaccaagttattggat
aagctcagcgatgacgagttgaagaaagaatccaagagtgaatcgaaaagtgacgcaata
tctagcattattagggctttgaagaatctgtctgttagggtgccaggcaaagaagaagta
atccgaactgttgaactgtttagacttaagattgtattaaggttattacagatgtcttcc
ttcaatggcaaaatgagtgccttaaacgagatgaacagattaataatgaacgtatcgtac
attactcatcgtaatactggctcttcatatccagatgatgattggctaacagcggatcga
atcgctgaatggatacaacaaaatgatgttcttaatgtagttttacgggacaatttacat
caaccacaatacgttgaaaaattagagaaaatccttcgttttgcgattaaagaaaaggct
gttacatttcgtgatcttgatttaatatgggcggcccaggctggaaaacacgaagccatt
gtaaaaaatgtgcatgatttgctagcaaagctagcttgggatttttccgcgcaacaactg
gattatttattcgactgttttcaaaaaagttggaccaatgcatctaataaacaaagagag
aaattgattgaattgattagacgtcttgcagaagatgataaagaaggcttcatggcccaa
aaagttttagaattattgtggaatttagttcacgacagggacgtccctattgaaattatg
gatttagccttgtctgcacatattaaaattttggactacaattgctcaccggatcgcgat
gtacaaaagacaaattggatcgataaatgtgtagaagagctgaaagaaagtaattgggtc
attccagctgtcaagcacatccaagaaatttgtcagctattttatgaggcacctcgagat
tattctcgttctcagccattatcgcatttattttatcgccatgaagttataaatcagtta
caacagaaacacaaaattgtttctgtaaccgcagaaaacttatcgatttatatgaataag
gccagagcacattttcaagcttttcgagagaattccacctcagacgttatgcctgcttcg
cactattcccattctcaacaagttgacgaaagacttacatttttgagatattgtttaaga
gacggccatctaattttacaattgcctgaagccgaacttatttggttttgcttggctgaa
aaaggaatccacttaagtgatagagaagcttgttttacttggttttctaggattttagaa
gataccactgtaatgcaacctgagacatgtcagaagttctttgaaaaaaatattctgacg
ttcgaccctagccttcttacagaaaacggcgtcaggtgctttgaattattttttcgtgct
gttaacggaggtactaaaattaataatgaaacaaagccgatatacaaacatgaccaagag
ctcattggtgtagattatatctggagggttgtattatgtagcgaagaggatgtggcaaat
aaagcgattgagttattgaaggaaacttatataaccttaaatccagatgtacagaatagt
caggttttggctgatagcgaatttatagagacttgcatgaaacgcttgcaagtgtcatgc
aacaatttaaggtcttttgctatgaccgaaagtagttccaccgaaagtcaagacatgatt
gtcagagaagctactcgtaacgttagagtcctgaaagtaataaaggattactttgcagac
tgtgatgatgaattttctggagataggacaatcttaccgcatgggaggttaaggtcttgt
ggtaataatcgtacggatttatatgtaaataatgaaattttaaatccggctgatgataac
aaattggtttgtgatatgccaatacgtgatagatcgatcatatatgcgaaagtaaatcaa
ggaattaattctgtaccgtcgtcgccagacagttcttcagaatcttcttctggctatcct
aatgggcattatgatggcccaaatattgatgcagaaaaatgcctaccaggagtggtattt
gctggaatggaaaaccatgttaaatttttgttcgacctggctgatgtgggtgctattttc
gaagcaaccgatggcatagtaaatggtgtctatgatttgctgcaacgattaccctcagca
aattttattacaaagaacgtagaaacggtgtgtaaaggtatagttgaacagtatgatgaa
gttcatgacggaggaatgttgaaaaaccaacttggggagaccgtttctctacgcagtctg
tattcgttagaggtaatttacgctatgttgatgcctgcttttttaccacaaagtgaaagc
actgaaaattttcagaaatcctttattaaatctggtggtttaagctatatttttagcttt
cttcggcaaaatatatctgagcaatcgtgtaatagaatgatacagaggcaattatgccat
ctgtgtttgaaaataggaaaatttttgctgaccgtaactggtcatgcccaggttgcaatc
gttgctgatgctgttcgtgaaaatggaaattcatctgttacgcctgctgcacactcggct
gctctagttttacaacaagctttgcagacagttccatgtcctcaatctgagtttatgtta
ataaatatcgccgcaaaaatggggaaaattatgaaagagaaggctacaaggtacatgcct
agtattgaagacatacggcttttcatcaagattgcttggacttccgctggcggtctcctg
tcttgcatcaatatctctatcgacgaattacagaaggctttccgtcatggaaagacctcg
acggttacatcgtgtattgacgaaggtcctgttgcaatggaagcccttgaggttttaggt
gtatccttggcgctgtgtccttcaattttggatacacttagtcgtgaaaagtcatggcag
ctgtttatcgtagacgtgttgtctgttcgaatttgtgctgctgagcagtttttaacgatc
gctactaagtgtagccctggaaatagatgtctcttacattttctagaactatttttttca
attttaacgactgctgtagaagaatttgcgctgttttctggagaatactttttgctttca
tgcaggctgttaaattacggccatgtaaccaaggtcccagtttctaaagcggagaacttg
cttcttaatgaaattagttggttacgaaatataaaggagaaatttaaaaagaataacgtg
cttggtgacattgatcaaatattactagacggccatctaagcgtcaccaaagagctctta
tcctttatctccggtcaaaagaaatcgtacattggctgcaaatatgacaacattagtttc
atagaggaactcatgtaccaatttttgtttcctgcttcgaagttgctacatgatattgga
tccaagaaagacgacataaattggaaacaggtgaagcgaatttgtcatacccctattact
actaatgccgcaatggatctattagtcgcattctgtgtcggttcaatatcgaacttccac
cttgtatgcaatattttatctgaattgtttaattacccggaaatttctaatgctttggat
gtctgggagtattctcctaccgttggatgtagaccttctaatggttatgttggactaaaa
aatggtggtgctacatgctatatgaattctgtgctacagcaggtatgtaaaagtgtccta
aacgttcagacaagttttgaaaaagaagaggtagacgcttacgacggttctgataaggga
ggcgatatcgagttgaatattgacccctatatccgggaagatcggcagaggtttcaagat
agtagaaaagatatgccgataaaagaatataatttatgtttgttaaagcaagtacagagt
atatttgcgcatttaaccgaaagtcttttacaatactatatccctcgtggtttctggaaa
atgtttcgtcttcaaggtaatccagttaatttaagagaacaacaggacgcttacgaattc
tttaatagtttagtggatacactggatgaagcattgaaagatcaaggttttccgccattt
ttgtcgcatgtttttggtggtacatttgctgatcaaaagatctgtaagggttgccctcac
cgttattcgcgagatgaatctttcaccgcaatcagcgttgatattcgtaaccatcagaac
atggttgaatctttagagcaatatgttaaaggagatttgctcgaaggcgttaatgcatat
tattgtgaaagatgcgataaaaaggttgacaccgtgaagaggatgtgtattaaaaagtta
ccaaagattttggcaattcagttgaaaagatttgattacgactgggaaagggattgcgct
gtaaaatttaacgattattttgagtttccacgtgaattcgatatggagccatttactgtg
gctggactggctaaaattgaagatgaaagcatagaagatatcgaaactgatagtgaagac
tctccagttactcagtaccggctagttggcatgattgtacacagtggtcaagctaatggt
ggtcactattattcttatataataaaaaggggtgaagatggtaatggtggtcagtggttt
aaatttgatgacggagatgttacagaatgtaggatggacgacgacgaggaattgaaatct
cagtgttttggtggtgaatacatgggtgaggtatatgatcaagtagtaaaaagaatgtca
ttccgacgtcaaaaaagatggtggaattcctatatccttttttatgaaagaaaagacatt
gtagataatgatggaaatatgcatggtttccagcaagctgtaaatatacctaaacaaatt
cacggtgccgtcattcgacaaaatatctattttttgcacgaacaaatgcattatagctac
gaatactttcaattcattcgtaagctaataattgccaactttcagcaccttagccgggat
aatcaaccacctgatctggaagaatttggtgttttaagtatcgagatggctagtaaattt
ttatttagtataggatttagaacgaaaaagggcattaggggttcatataacgactggtac
gatgctattgcgttaatatttcgccatagtagaaatgcaagaatatggtttgcacggaat
gtgctatttgcgcatcctcaaagatttacagaatatctattggaatgtccagttggggag
atgcggtacacatttgccaaaattattgttacactatgccatctgacattgatagaaaca
ccgacatcacctttgagattatcatcagcggataatgatgacgaggagaccgaatatacg
cattctattagtgataacattcttaaggcagttttatcgctaattaatagagatttgcct
gaacatggccgatattatcaacagtattttcagttgtttttaatgtatgctaattttgga
atgggccagagaattcaactgctacgcttaggcgttgcagatgtctttatgaacttaagt
tcggacgaaaatacgggatcggtattgagataccaatctcaggatcttagtaaactacat
gcagttacttcgatacttattcgcagctgtgatatatccaataaagaaaaacaatgtgaa
accatgcctggcaattatggagaaaacccatataccgagctctcaccacatgatcataaa
aaatggattctaccgttacctcgagaagtagaaatgttgttatttatcagaaaaatatat
ttgaagaagatcttggaagaatatcctggaaatgaagaaaccgccaagttgatcgagttt
tgttcttgggaaaatgagcatttctcgaggctgattgtttccaagctgctctattatatc
cagcacgctccgtctggggatcgtttaaagccttacatagatttatttgttagtgtgttg
accatagaagattcttggcaacaacagcgtatacacctagctatgcaaggtatttccgat
gaacgacttggtatctttgatatcattatcaactctcgtggtcgtcatcaaaagcgctca
tatttgtgtatgaaattccttgtatcatttattcctagctatagagtggcattggaatta
tttcaagataatcatgtttggaagcaaaagtggactgaagcagttaactggctaggagac
gaattggataggaatacctatcctaccggtagcggctatggttatacaaattggtctccc
cctgcacaatcgaacgaaacttcggctggatcacttttggaacgatctaatagtgcacgt
gttgtttacgcgaaagctttggaattagtcgatgagggtgaatatgatgatattgaagaa
atcgatgaacttaacgctcaaaatgagcgtaacaaacgctatcacgcagcccctaatcgt
tactttccggaatctgacgataatcttgctgctagcgaatcgacgcggcacgaaaattct
gatgaagaaaatagaggctcaaggagaaatttaggaaattaa

DBGET integrated database retrieval system