KEGG   Trichoplax adhaerens: TRIADDRAFT_59600Help
Entry
TRIADDRAFT_59600  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
tad  Trichoplax adhaerens
Pathway
Glycerophospholipid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    TRIADDRAFT_59600
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    TRIADDRAFT_59600
Enzymes [BR:tad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     TRIADDRAFT_59600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 462 aa AA seqDB search
MKSFDIITLTMLTLAVGAVNADMGNWKDLYTERGKDAFVNKMKEPYIKYQNEEKNPLRSP
SVRSFINKLKASNKKKMYPVMLVTALLGAQLEAKLDRKSVPYFYCKKKSKWELIWVNIED
FLPFIIDCWEDNIKLKYDAVTHVYSPAAEGVQVRVRTGIENIRFIDPSGLLKSLTGEYNT
IINALESIGYQQNKNLIAAPYDWRVGADSYYLPNGIFHNLKKMIEGAYANNSNTPVVCVA
ESLGNPVLTLFLNTYVSEAWKAKYIKSYIALAGVFAGAGQTVAGVLSPILDGLPDFIDPN
IIRTLARSFGSIAWLFPNAKYWKDYVFLSTPTRNYTASDIGALLEQQSLHGVYEMYLNNK
DLTTLQAPNVTVYCWHGIGVKTPNIFQYDSDNFDQKPKVIEVDGDGRVPLPSLQVCRRWK
DEQSQPVSYRSLPGVTHVGILSNERVVLDILSVATGGQPFSD
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaagagctttgatattatcacattaacgatgttaacgttagctgttggggccgtaaac
gctgacatgggaaattggaaagacttatatactgagagaggaaaggatgcatttgtgaac
aagatgaaagaaccatacatcaaatatcaaaatgaagaaaaaaatcctcttcggtctcct
tcagttcgcagttttattaacaaacttaaagctagtaataagaaaaagatgtatcctgtc
atgcttgttacagccctattgggagctcaactcgaagctaaacttgacagaaaaagtgtt
ccatacttttattgcaagaaaaagtccaaatgggaattgatatgggtaaacattgaagat
tttcttccctttattatagactgctgggaggataatataaaattaaagtacgatgctgtt
actcacgtttattctccagcagcagaaggtgtccaagtaagagttcgtacaggaatagaa
aacattcgattcattgacccatcgggattgctgaaatcattaactggagagtataacacc
attatcaatgctctggagagtattggatatcagcagaataaaaatttgatagctgctcct
tacgactggcgtgttggagctgattcttattatttaccaaatggtatatttcataatttg
aaaaaaatgattgaaggagcatacgcaaacaatagcaatactcctgtggtttgtgtggca
gaaagtttaggcaatccagtcttgactttatttttgaacacctatgttagcgaagcatgg
aaagcaaaatatataaaatcttacattgctctagctggagtattcgcaggtgctggacag
acagttgctggcgtgctatctccaatactagatggattacctgattttattgatcctaat
attattcgtacgcttgctcgaagtttcggcagtatagcatggctatttccaaatgcaaag
tactggaaagattacgtttttctcagcacaccaacaagaaattacacagctagtgatata
ggcgctctattggaacagcaatcattgcatggcgtttatgaaatgtatttaaataacaag
gatttgacaactctgcaagctcctaatgtcactgtctattgctggcatggtataggagtc
aaaaccccgaatatttttcagtacgatagtgataattttgatcaaaagccgaaagtaatc
gaagttgatggcgatggacgtgtacctttaccaagcttacaagtttgtagacgttggaaa
gatgagcaatcgcagccagtatcatatcgttcactaccgggagttacacatgtcggcata
ttaagtaatgaaagagttgttttagatattttatctgtagctacaggtggccagcccttt
tctgattag

DBGET integrated database retrieval system