KEGG   Trichoplax adhaerens: TRIADDRAFT_59602Help
Entry
TRIADDRAFT_59602  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
tad  Trichoplax adhaerens
Pathway
Glycerophospholipid metabolism
Lysosome
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:tad00564]
Cellular Processes; Transport and catabolism; Lysosome [PATH:tad04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 460 aa AA seqDB search
MASLIGVKICIYFFMVWTVVGPSTVHALNWKQFYSQEKYQSMAKEFHRFYSKSNFNRDKV
SQFAKEIKANGTNVMHPVVLITALGGAQLEAKLNRTTAPYWFCDKKTDWELVWLNVDFLL
PFVIRCWENIMQLKYDSKNHVYSPAHEGIKIRVRNGTKHIRFIDPQFGLRGVSMEYGAII
DSLVFTGYTKDKNIIAFPFDWRIGADAYYLKNGVFHYLKLAIEQAYSNNSNIPVVCVGES
MGNAMFNLFLNTYVDQKWKDKYVKAHISLSGVYAGAGQVIYSVISPSGGVLPPVVNFDVI
RSVIRTYGSSAWLLPNRKFWKDYPFVRTKKKNYTAEDFGEIFSRLKLHNITEMWHNTRNL
STLHAPNVTVYCWHGINVPTPNSFYYKDDNFEKQPDITHTDGDGTVPLRSLQVCQNWKKQ
QTKPVSVRSFPGVSHMGILGDESVIMGILSIATGGHPSHG
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcattgataggagtcaagatctgtatttacttttttatggtatggacagtggta
ggtccatcaactgttcatgcattgaattggaaacagttttattctcaagaaaaataccag
tctatggcaaaagaatttcacagattttatagcaagtccaatttcaatcgggataaagtc
agtcaatttgctaaagaaatcaaagccaacggtactaatgttatgcatccagtggtattg
attacagccctaggtggagcacagttagaagctaaactcaatagaacaacggcaccgtat
tggttttgtgacaaaaaaaccgattgggaattagtttggctaaatgttgattttttactc
ccatttgtcataagatgctgggaaaatattatgcaattaaaatatgatagcaaaaatcat
gtttattcacctgcccatgaaggtatcaagattagagttcgtaatggaacaaagcacata
cgcttcattgatccacaatttggcttgagaggtgtcagcatggagtatggcgctattatt
gattcattagtttttactggctataccaaagacaaaaatataatcgcattcccgtttgac
tggcgtataggagctgatgcttactacttaaagaacggagtttttcattacctaaagctt
gcaattgaacaagcttattccaacaacagtaacatacctgttgtttgtgttggcgaaagc
atgggaaacgcaatgttcaacttatttctaaatacttacgtggatcagaaatggaaagat
aaatacgttaaagcgcatatatcattatctggtgtttacgctggcgctggccaagtgatt
tatagtgtgatttctcccagcggcggtgtcttacctccggtcgtcaactttgatgttatt
agatcggttattcgaacttatggaagttctgcatggttactaccgaatagaaaattttgg
aaagattatccgtttgttcggacgaagaagaaaaattataccgctgaagattttggtgaa
atattctctcgtttgaaactgcataacataacggaaatgtggcacaatactagaaactta
tcaactttacatgctccgaatgtcacggtgtactgctggcatggcataaacgttcctaca
ccgaatagcttctattacaaggatgataattttgaaaagcaacctgacattacccacact
gatggtgatggaacagtacccttacgtagtttgcaggtgtgccagaattggaaaaagcaa
caaacaaaacccgtgtctgtaagatcgtttccaggtgtaagtcatatgggaattctaggg
gatgaatctgttataatgggtatactttctattgcaactggtggccacccatcccatgga
tag

DBGET integrated database retrieval system