KEGG   Trichoplax adhaerens: TRIADDRAFT_59822Help
Entry
TRIADDRAFT_59822  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
tad  Trichoplax adhaerens
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    TRIADDRAFT_59822
Enzymes [BR:tad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     TRIADDRAFT_59822
Transfer RNA biogenesis [BR:tad03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    TRIADDRAFT_59822
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 304 aa AA seqDB search
MAVAPILLRMVASSVSLAASAGQHIRRIMKTGHLEVIDKGINDPQTEADRVAQQHIIGSL
IRQYPKATIIGEEDLDPNDISPELFSSDSSEDVLKLKCHEKIHSIKEEDVVVWVDPLDGT
REFAQGFTDHVTVLIGFAFEGKPIAGIIHQPYYKNSESRLGRTLYGIVGIGTYGFTYTTP
PNDRCIVISTKSRISQVITDSINAMKPDKVLHVGGAGYKTVLLLEGAADVYLYASKGTKK
WDTCACEALVETIGGKLTDVFGNHMQYHKTVEHINEFGVLATMQNHDRYVSRIPISVRNT
FSKI
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggctgtagctccaatcttgcttcgaatggtggcttcgtccgtatcactggctgcttcg
gctggccaacatattcgtagaattatgaaaactggacatcttgaagttatagataaggga
attaatgatccgcaaactgaagctgaccgtgttgctcagcagcatattatcggttcgtta
ataaggcaatatccaaaggcaaccatcattggagaagaagatctggatccaaatgatatt
tcgccagaattattttcttctgattcaagtgaagatgttcttaaactaaaatgtcatgaa
aagatacacagtataaaagaagaagatgtcgtcgtttgggttgatccattagacggaact
agagaatttgcacaaggcttcacggaccatgtaactgtcctaattggatttgcatttgag
ggtaaacctattgctggtatcattcatcaaccttattataagaacagtgagagtcggctt
gggcgcacactatatggtattgtaggcattggaacctacggctttacttacacgacaccg
ccaaatgataggtgtatagttatttcaactaaatcacggattagtcaagttatcactgac
tctattaacgcaatgaaaccggataaagttcttcatgttgggggtgctgggtacaagacc
gttctactactagaaggtgctgctgatgtatatctctatgcaagcaaaggaacgaaaaaa
tgggatacttgtgcatgcgaagctcttgtggagactatcggagggaaacttacagatgtt
tttggcaatcatatgcagtatcataagactgttgaacatattaatgaatttggagtgctt
gctacgatgcaaaatcatgatcgctacgtcagtcgtataccaatatccgttcgaaacaca
ttttctaagatttaa

DBGET integrated database retrieval system