KEGG   Trichoplax adhaerens: TRIADDRAFT_59828Help
Entry
TRIADDRAFT_59828  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
tad  Trichoplax adhaerens
Brite
Enzymes [BR:tad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     TRIADDRAFT_59828
Peptidases [BR:tad01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   TRIADDRAFT_59828
Exosome [BR:tad04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   TRIADDRAFT_59828
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
AA seq 293 aa AA seqDB search
MTFYDVKCLTVDCAKSNDMLRIPFSNASQPQQFGMTGTRNFMVKTSDNEFLGAWHVLPKS
LIPTVDDQIDFDNSLKSGKPIFIYFHGNSGSRASYHRIEIYKRFSSFDYHVVTVDYRGYE
DSSGIPSEEGLTEDGISLWKWTKQRSGSSPIYIYGHSLGGAVAVNVAARLCDSDECPKGV
IIQSSFSSLQEACYGHILSKPLKILPFYYSNVLNVVSGEYMVKERIRGVHCPILIIHANQ
DAVIPISLAEELYKAAKSRPASSGKVVLEKLDDTQLGHNNIHRFDRFSDMIRY
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgacattttatgatgtcaagtgtttaacagttgactgtgcaaaatcgaatgatatgctt
cgtatacctttttctaatgcttctcagccccaacagtttggcatgactggaaccagaaat
tttatggtgaaaacaagtgataatgaattcctgggtgcttggcacgttctccctaagagt
ttgattccaactgtggacgaccagattgatttcgataatagcctgaaatcaggcaaacct
atttttatttatttccatggtaattcgggctctagagcgtcttatcataggatagaaata
tataagagattttcttccttcgattaccacgttgttacagttgactatcgaggatacgaa
gattcttctggaattccttcagaggaaggcctgactgaagatggaatatcattgtggaaa
tggactaaacagaggagcggttcatctccaatatatatttatggtcattcactgggaggc
gctgttgcagtaaatgtcgcagctcgcctatgcgactctgatgaatgtccaaagggtgta
ataatccaaagttcgttctcttcactacaagaagcttgctatgggcatatactcagtaag
ccgcttaagatattgccattctattattccaatgtattgaatgtagtatctggtgaatac
atggttaaagaaaggattcgtggagtgcattgccctattttgataatccatgcaaatcaa
gacgcagttattccaatttctttggctgaggagttatataaagctgctaaatcaagacca
gcatcttcaggaaaagttgtcttagaaaaactcgatgatactcagcttgggcataataac
atccatagatttgatcgattttctgatatgattaggtattga

DBGET integrated database retrieval system