KEGG   Trichoplax adhaerens: TRIADDRAFT_60057Help
Entry
TRIADDRAFT_60057  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
tad  Trichoplax adhaerens
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 164 aa AA seqDB search
MLSRWGILDRRWISAIRQLAGNGCSLKPVQALWSGWSRPIYTSPLSLQDQPLRGRGRRTE
TDESRRANTSTNTTTESKPVWASYRRNHKGMIPPQRRGKVASNPCPICRQKSGTLDYTNV
NFLKQFISPFTGKIYEPFVTGLLPTPIPLNLPIPEQPMSRNDSL
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgttgagccgttggggtatattagatcgtcgatggatatcagcgatacgacaattggcc
ggaaatgggtgctctctgaagccagtacaagcgctatggagcggatggagtagacctatt
tatacgagtccactgagcttgcaagatcaaccgcttcggggtcgaggtcgaagaactgaa
acggatgaaagcagaagagcaaacaccagcacgaatactacaacagaaagtaaacctgta
tgggcatcatacagacgaaatcataaaggcatgattccacctcagagaagaggtaaggta
gcatccaatccatgtccgatatgccgacaaaaatctggaaccttggattacacaaatgta
aactttctgaagcaattcatttcaccttttactggcaagatatatgaaccattcgtaaca
ggtttactacctactccaatcccattgaatttacctatacccgaacaacctatgtcacgg
aatgattcgctatga

DBGET integrated database retrieval system