KEGG   Trichoplax adhaerens: TRIADDRAFT_60057Help
Entry
TRIADDRAFT_60057  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K16174  small subunit ribosomal protein S18b, mitochondrial
Organism
tad  Trichoplax adhaerens
Brite
Ribosome [BR:tad03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    TRIADDRAFT_60057
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_S18
Motif
Other DBs
NCBI-GeneID: 6757242
NCBI-ProteinID: XP_002116029
JGI: 60057
UniProt: B3S764
AA seq 164 aa AA seqDB search
MLSRWGILDRRWISAIRQLAGNGCSLKPVQALWSGWSRPIYTSPLSLQDQPLRGRGRRTE
TDESRRANTSTNTTTESKPVWASYRRNHKGMIPPQRRGKVASNPCPICRQKSGTLDYTNV
NFLKQFISPFTGKIYEPFVTGLLPTPIPLNLPIPEQPMSRNDSL
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgttgagccgttggggtatattagatcgtcgatggatatcagcgatacgacaattggcc
ggaaatgggtgctctctgaagccagtacaagcgctatggagcggatggagtagacctatt
tatacgagtccactgagcttgcaagatcaaccgcttcggggtcgaggtcgaagaactgaa
acggatgaaagcagaagagcaaacaccagcacgaatactacaacagaaagtaaacctgta
tgggcatcatacagacgaaatcataaaggcatgattccacctcagagaagaggtaaggta
gcatccaatccatgtccgatatgccgacaaaaatctggaaccttggattacacaaatgta
aactttctgaagcaattcatttcaccttttactggcaagatatatgaaccattcgtaaca
ggtttactacctactccaatcccattgaatttacctatacccgaacaacctatgtcacgg
aatgattcgctatga

DBGET integrated database retrieval system