KEGG   Trichoplax adhaerens: TRIADDRAFT_60973Help
Entry
TRIADDRAFT_60973  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
tad  Trichoplax adhaerens
Pathway
FoxO signaling pathway
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:tad00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    TRIADDRAFT_60973
   04330 Notch signaling pathway
    TRIADDRAFT_60973
   04350 TGF-beta signaling pathway
    TRIADDRAFT_60973
   04630 Jak-STAT signaling pathway
    TRIADDRAFT_60973
   04068 FoxO signaling pathway
    TRIADDRAFT_60973
Enzymes [BR:tad01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TRIADDRAFT_60973
Transcription factors [BR:tad03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    TRIADDRAFT_60973
Mitochondrial biogenesis [BR:tad03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    TRIADDRAFT_60973
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1526 aa AA seqDB search
MAQKLIGAILPPPAIMIKDERKVRLITYAHDVERDMYQKANSKEEYYQMLAVKIYKIKKE
LEEKRKTRLAKEGVNFLPNRENSQVPLANNDKPISKQLIQNLNPALPNTKARGGDPSASN
NSSRVSSPCDEMSNSRKSVSEKKMFSKEELHQPLMAVLQKLSSSADAEPFREPVDPKVLN
IPDYFDIIKHPMDLSTISRRLHQGMYKSPWGFCDDMWLMFENAWLYNKKNTRVHKQCTKL
AELFEKEITPVMRGFHYCCGKKYVFNPQVLCCYGKQLCTIPRDKVYWTYQDRYHFCEKCY
SEIEGENVRIGDDPIIPQSMGYLDSAIPKKYFKKKTNDHLEPEPWTACIDCGRKFHSICV
LHYDQLSSNGYICSHCLKTSGSRKRDSKYSANKLPDSNLSDHIEKRVNNFLKGKGAGNVT
VRMVSNVEKTVEVKQGMRTKFQDQFPESFPYRAKALFVFEEIDGTDVCFFGMHVQEYGTD
CSPPNKSYTMAHIWACPPSEGDDYIFHCHPPEQKIPKPKRLQEWYKRMLDKAKKESVVVD
YKDIHRMSQEENITSANQLAYFEGDFWPNVLEENIKEIDQEEQERKASAAAEAAGQGSNG
TKKTAKKGKMKKNSKSKTNNTRKNKKNPYAGTDLTQRLFATMEKHKEVFFVIRLYSVEEA
KEVPDIKDPDLVMSCDLMDGRDAFLTLAREKHFEFSSLRRAKYSTIAMLVELHNQGQDRF
VYTCNNCSNHVETRYHCSICDDFDLCLSCYDKFGHEHKMEKLGLDLGNECNGDDKSRNPQ
ESRRLSIQRCVWSLQHACTCPGCDVKSCNKMKWIVQHSKNCKTKNSGCHVCKQLIALCCY
HAKTCNDNHCPVPFCSSIKQKLRMQQMQRDQWTRRRMAVMQTSTPAYNNQFVSQEPIQQT
VRSQVAYNSMQGGPSRGPPNNIGSKDALKQGRNPHTMQIGMGRGQLRNASPSLISQSPSS
LGNNPAVGRQTFTSSENNYQPYRNPVRPDINRNLNRNNDLAVQHMDPSKAPKVMTEQKQK
MLQMLQNNYQHSVPNNVNQNPTNSMTGNYVKSAQDPSNQFLPNKQVQLQQQMNKQQIYPG
QANPTMQRLNNQPNRQHFQQQQQQQQQSHQMQPPQRQMAAQQFQQPLQQQSRPQGLQHNQ
IRQVQMPQQQLQASHPTQMISSNPINGNNQIKSGSVMQQQPSGVQQSQRFMTQPVMGQNP
RMSQQRVVKGPLHQNVNKTSLNTMTPQQRVMSPTQSTHGPPAGIAQQRNSFQSRNVVSSQ
QQVISSSQGLIGQNPAVSSRNLSASQQGVLSTPSVPQAPPNVNQRSIIIPPRNFQDRVIS
PHTSQAGVSQQQSPVMSPRNMHPLPQRVLSPAQSLPASSMVSPQGNVLSPRGLQNHQGKV
MSPTQSMPNASVVSPQNHQIRSGAGITPTQQQQVMSPTMANQQAHGAQSALSPRNQSYHS
NVMMASPPHISLSPRPAQSYQIGASPIPNKSPASVTHKPNQSPIMQDTNFSMNNVSSLPS
TNIASDHLGQDDDPLLSQDHLSQYVM
NT seq 4581 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaaaactgattggagctatccttccacctccagcaattatgattaaagacgag
cgcaaagtgcggctgattacgtatgcacatgacgtagagcgtgatatgtatcaaaaggct
aatagcaaggaagagtattatcaaatgttagccgtgaaaatctacaagataaagaaggaa
ttggaagaaaaacgtaaaactcgtttagcgaaagaaggagtaaattttttgcccaatcgg
gaaaattctcaagtgcctttagcaaacaacgataaaccgatatcgaaacaattgattcaa
aatttaaatccagccttaccgaacacgaaggctcgtggtggtgatccttcggcgtccaac
aattcttctagggtatcttccccttgcgatgaaatgtcgaattcacggaaatctgtttcc
gaaaagaaaatgttcagcaaagaggagttgcatcaacccttgatggcagtattacagaag
ttatctagctccgctgatgctgagcctttcagagagccggttgatccgaaagtattgaat
attccagattattttgatatcataaagcatcctatggatttatctacaattagtcgccgt
ctgcatcaaggaatgtacaaaagcccatggggattttgtgatgatatgtggttgatgttt
gaaaatgcctggttatacaacaagaaaaatacgagagtccacaagcagtgcactaagctt
gctgagctatttgaaaaagaaattacccctgtcatgagaggttttcattactgttgcggg
aaaaagtatgttttcaaccctcaagtattgtgttgttatggaaaacaactgtgtactatc
ccaagagacaaagtttattggacttatcaagacagataccatttctgtgaaaagtgttat
agtgaaatcgaaggtgagaatgttagaataggagatgacccgatcatccctcagagtatg
ggatatcttgatagtgctataccgaagaaatactttaaaaagaaaacaaatgatcactta
gaacctgaaccctggacagcttgcatagactgtggacgaaagtttcattccatttgtgtc
cttcactatgatcaactatcatctaatgggtacatatgtagtcattgtttgaaaacttct
ggatcaaggaaaagagatagtaaatattcagctaacaaacttccagattcgaatttaagt
gatcacatagaaaagagagtcaataatttcttaaaaggcaagggtgccggtaatgttacc
gtgcggatggtatcgaatgttgaaaaaactgtagaggtgaagcagggaatgaggacaaaa
tttcaagatcaatttccagagtcattcccatatcgtgctaaagccctattcgtttttgaa
gaaattgacggaacagatgtatgcttctttggtatgcatgttcaggaatatggaacagat
tgctcaccccctaacaaaagttatacaatggcacatatttgggcttgtcctccaagcgaa
ggtgatgactatatctttcactgtcatccacctgagcaaaagatacccaaacctaagcgc
ctgcaagagtggtacaaaaggatgcttgataaggccaagaaagagagtgtagttgttgat
tacaaggatatccatagaatgtcacaggaagaaaacattaccagtgctaatcagttggca
tatttcgagggcgatttctggccaaatgttctagaagagaatattaaggaaatagatcaa
gaagagcaggagagaaaggcgagtgcggcggctgaagctgctggacagggttctaatggt
acgaaaaaaacggcaaagaaggggaaaatgaagaaaaatagcaaaagtaagacaaataat
acacgaaaaaataaaaagaatccatatgctggaacggatcttacgcagcggctatttgca
actatggaaaaacataaagaggtattctttgtcatccgattatactctgtggaagaggcg
aaagaagtaccagatataaaagatccagacttagtcatgtcttgtgatttaatggatggt
cgtgatgcatttttaacgttagctcgtgaaaagcactttgaattttcctcattaaggcga
gcaaagtactcgacaatagcaatgctagtagaattgcataatcaagggcaagacagattc
gtatacacgtgtaacaattgtagtaatcacgttgaaacaagataccattgttcgatatgt
gatgactttgatttatgtttatcctgttatgataaatttggacatgaacacaaaatggag
aaattgggcttagatttagggaatgaatgtaatggtgatgataaatctcgaaatccacaa
gaatcacgacgcctatcaatacaacgatgtgtctggtcattgcagcatgcttgtacttgc
cctggatgcgatgtaaaaagttgtaataaaatgaagtggatagttcagcatagtaagaac
tgtaaaacgaaaaactctggttgtcatgtttgcaagcagctcatagcactttgttgctat
catgcaaaaacttgtaacgataaccattgtccagttccattctgttcaagtattaaacaa
aaattacgtatgcagcagatgcaacgtgatcaatggacaagaaggcgaatggctgtaatg
caaactagtactcctgcatacaataaccaatttgtctcccaagagcctattcaacaaact
gttagaagtcaagttgcatataattcgatgcagggtggtccttctcgtggaccacctaac
aacatcggctctaaggacgcattaaaacaaggacgtaatcctcatacaatgcaaattggt
atgggtagagggcaattacgaaacgcatcaccatcgttgatctcacagtcaccatcatct
ctgggtaataatcctgctgttgggcgacaaacgtttacatcttcagaaaataattatcaa
ccttatcgaaatcctgtacgaccggacattaatagaaatttaaatcgaaacaatgacctt
gccgtacaacatatggatccttcaaaagcgcctaaagttatgacagaacaaaaacagaaa
atgctacagatgttacaaaataactatcaacattctgtacctaataatgttaatcagaac
ccaacaaatagtatgactggaaactatgtgaaatctgctcaagatccatcaaatcaattc
cttcccaataagcaagtgcaactgcaacaacaaatgaataagcagcaaatatatcctggc
caagctaacccaacaatgcaacgcttgaataatcagccaaataggcaacattttcaacaa
caacaacagcagcagcaacagtcgcatcaaatgcaaccaccacaacgtcaaatggcagca
caacaatttcaacaaccgctgcaacaacaatcacggcctcaaggtcttcaacataaccaa
attcgacaggtgcagatgccgcagcagcaattgcaagcgtcacatccgacgcaaatgatt
tcatcgaatcctattaacggtaataatcaaataaaatcaggttcggttatgcaacagcaa
ccatctggtgtgcaacaatcacaaagatttatgacgcagccagttatgggtcaaaaccca
cgaatgtctcagcaacgcgttgtaaaaggcccattgcatcaaaacgttaataagacatca
ctaaatactatgactccacagcaaagagtcatgtcaccaactcagtcaacccatggaccg
ccggctggaattgcccagcagcgtaacagttttcagtcacgtaatgtggtatcttcacag
caacaggttatttcgtcttcacaaggacttatagggcaaaatccagcggtgtcctcaaga
aatttatcagcatctcaacaaggagtgttatcaacaccttcagtgcctcaggcaccaccg
aacgtgaatcaaagaagtatcattataccacctagaaattttcaagatagagttatttct
cctcatacatcgcaagccggtgtatctcaacaacaatcgccagttatgtctccgagaaat
atgcatcctctgcctcagagagttttgtctcctgctcaatcattgcctgcgtcgtctatg
gtatcacctcaaggcaatgtattatccccaaggggactgcaaaatcaccaaggaaaggtg
atgtctccgactcaatcaatgcctaatgcttctgttgtatcgcctcaaaatcatcaaatt
cgaagtggcgcaggtataacgccaactcagcaacaacaagtgatgtcacctacaatggcc
aatcaacaagctcatggtgcacaatcagcgctatctcctagaaaccagtcatatcattct
aatgttatgatggcctcacctcctcatatatctctatcgccaaggccagctcagtcttat
caaatcggtgcttcacctataccgaacaagtctccggcctcggtgacacataagccaaat
cagtcaccgattatgcaagatacaaatttttctatgaataatgttagctctttaccatcc
accaacatagctagtgatcacctaggacaggatgacgatccgttattatctcaagatcat
ctaagtcagtatgtaatgtag

DBGET integrated database retrieval system