KEGG   Trichoplax adhaerens: TRIADDRAFT_61268Help
Entry
TRIADDRAFT_61268  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tad  Trichoplax adhaerens
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TRIADDRAFT_61268
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TRIADDRAFT_61268
  Amino acid metabolism
   00310 Lysine degradation
    TRIADDRAFT_61268
Enzymes [BR:tad01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     TRIADDRAFT_61268
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 405 aa AA seqDB search
MRLFDNVITIQAPTFPESISEGDIRWLKEVGDTVEENDTIGEIETDKTTMAVLAPESGVI
EEFLIPDGEKVTQSQNIAKFKVAAGSESGSQSTETKAPSPSPATAETKEVPPNAESPPAQ
AAEIPSAPPPVPNIPESPISATPIPPVSQKRPIAAAVPQPIEPMPSGVRSERRVKMSRMR
LRIAERLKAAQNTCAMLTTFNEVDMSNVIEMRNAYKESFLKKHGAKLSFMSPFIKASAFA
LRDQPVINAVIDGKEIIYRDYVDISIAVATPKGLVVPVLRNVETMNYGDIEKNVATLAEK
ARHNNITVEDMEGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGVFDRPIAVKGKVEIR
PMMYIALTYDHRLVDGREAVLFLRKIHVSFIVRDRSSLGKLKFSC
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgcgattatttgataatgtaattaccattcaagcccctacgtttccagaatctattagc
gaaggagatattcgttggctcaaagaggtgggtgatactgttgaagagaatgacactata
ggtgaaatagaaactgataagacaactatggcagtgcttgcacctgaatctggagtaatc
gaggaattccttattccggatggtgaaaaagtaactcaaagtcaaaatattgcgaaattt
aaagttgctgcaggcagcgagtcaggttcacaatctacggaaacaaaagccccttcgcca
tccccagcaacagcagaaacgaaggaagtgccaccgaacgcagaatccccgccagctcaa
gctgctgaaattcctagtgcaccaccaccagttcctaacattcctgaaagtccaatatct
gcgacgccaattccacccgtaagccagaagaggcccatagctgctgcagtgccacagcct
atagagccaatgccgagcggtgtgcgatcagagagacgagttaaaatgtcacgcatgcga
ttaaggattgccgaacgcctgaaggcggcacaaaatacctgtgctatgctcacaacattt
aatgaagttgatatgagtaatgtaatagagatgagaaatgcttataaggaaagctttctc
aaaaagcatggagccaaacttagttttatgtcaccattcattaaggcgtccgcgtttgct
ttacgtgatcagcctgtaatcaatgctgttattgacggaaaagagatcatatatcgggac
tatgttgatattagtattgccgtagccacgcctaaagggttggttgttcctgttcttaga
aatgtcgagactatgaactatggtgacattgaaaaaaatgtagccactctggcagaaaag
gcaagacataacaacatcactgttgaagatatggaagggggaacctttactatttcgaat
ggtggtgtttttggatctttatttggtacacctattataaatcctccacagtctgcaata
ttaggcatgcatggagtatttgatagaccaattgcagttaaaggaaaggttgaaatacgt
ccaatgatgtatattgctttaacatacgatcatcgactagtggacggtagagaagcagtg
ctattcctgcgcaagatccatgtctcattcattgtaagagatagaagttctttgggtaaa
ttaaagttttcgtgttga

DBGET integrated database retrieval system