KEGG   Trichoplax adhaerens: TRIADDRAFT_61433Help
Entry
TRIADDRAFT_61433  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
tad  Trichoplax adhaerens
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:tad00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    TRIADDRAFT_61433
Messenger RNA biogenesis [BR:tad03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     TRIADDRAFT_61433
   mRNA cycle factors
    P-body specific factors
     TRIADDRAFT_61433
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 729 aa AA seqDB search
MSMLSIRCQLADCHRSIPLLRLQVYFKEEVEVGNISLSNCSQPVAIPAQSQIENQSQESL
QNVNCLDLRPSSEEGDMSTGNVSSPKKSSVDDFSERIANLTSDIEKILGQSISSPTGTPS
ESKNSAIKARQRLRNRNKSPIKAYTPTTPEVNDYAATKHHVYDVNSILPIDAPANLSSDI
SDQSMDSTKTSNDFKGPAVAVTVSDQDADGDIDYSNVSFNPEKIAQAFDFSEATVNQQGN
FVRVGTFRKKKTDNRPTIIPNIESPIASPTVAGNSLFVPNNDGANFALPIAPTTDNAEDN
LVAAPMMDSGQGRNYSSATMIKKPKEPVNHTPASQQQIDEDEFVMAIEEGFKSSQAFTQE
LDYLEKIGTGATVQESALARQSLYVKFDPYVKPSMKNRNKFKPMPPSNENLLLLESPNSY
MTNDETQPSPTEQDVSLPQDTAVQRSDVDKLLSFSPQAEQSNTTTTATVPTEPGEQEIFI
DTQPSVAINQPVSIQLQETPKSKSQNTEKTVSDQKPQTGPTLMETEIVSQQLQKENQSLR
KEINALRKGREMDRKENEELNFLSIKAILKCEIDGCYYIETTETQKAEHNREIEEICRER
DQAQADINSVETAFSDLHKRYEKLKGFVEGYRKNEETLKACIVEYQQKLKKSEKRYQTLK
NHAEEKIDSANKEIINVRKGQQAELAALQAALRREQAKNAGLESSLKQKAQENAELTSIC
DELIGKIGK
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatgctatcgattcgatgtcaacttgctgattgtcatcgaagtattcctctactc
cgtctgcaggtctactttaaagaagaagtggaggttggtaacatctcgctttccaattgt
agccagccagtggcaattcctgcacaatcgcaaattgagaatcaatcgcaggaatcactt
caaaacgtcaattgccttgatttacgtccctcaagtgaggaaggtgacatgtccactggc
aatgtatcgtcaccgaaaaaatcctccgtagatgatttctcggaaaggattgctaactta
acttctgatatagaaaagattttgggccagagtatatcaagcccaactggtacacccagt
gaatcaaaaaatagtgctataaaggccagacaacgattgcgtaaccggaataaaagccca
attaaagcttacactccaacaacgcctgaagtaaatgattatgccgctacgaaacaccat
gtttatgacgtcaattcaattttaccaatagatgcccctgccaatctatcctctgatata
tcggaccagtcaatggatagtaccaaaacaagcaatgatttcaaaggaccagcagttgct
gtaacagttagtgaccaagacgctgatggagatatagattatagcaatgttagctttaat
ccagaaaaaatagcacaagcgtttgattttagcgaagcaaccgtcaaccaacaaggtaat
tttgtacgggttggaacgtttcgtaagaaaaagaccgacaatcgccctacaattattccc
aacattgaaagtcctattgcttcacctacggttgccggcaatagtttattcgtaccgaat
aacgatggtgcgaattttgctttgcctatcgctcccacaactgataatgcagaagataat
ttagtagctgctcccatgatggattcaggtcaaggaagaaattatagtagtgcaacaatg
ataaagaaaccaaaagaaccagttaatcataccccagcatcacaacaacaaatcgatgaa
gatgaatttgttatggcaattgaagaaggctttaaatcaagtcaagcatttactcaagaa
ttagattatctagagaaaattggtactggtgcaacggtgcaagaatctgcgcttgctcgg
cagtctttatatgttaagttcgatccatatgtaaaaccttccatgaaaaatcgaaataag
tttaagcctatgccaccttccaatgaaaatctattactattagaaagtccaaactcttac
atgaccaatgatgaaacgcaaccaagtccaactgagcaggatgtctccttaccgcaggat
accgctgttcagcgatccgatgtagacaaacttttatctttcagtcctcaagcagagcaa
agtaatactacaacaactgctacggtacctactgaaccaggcgaacaagaaattttcatt
gatacccaaccctctgtggccatcaatcagccagtgtcaatacaactacaagagactcca
aaaagtaaaagtcaaaatactgaaaaaacagtatctgaccagaagccacagactggccct
actctaatggagactgaaattgtaagtcaacagttacaaaaggaaaatcaaagtttacga
aaggaaatcaatgccctaaggaagggacgtgaaatggatcggaaggaaaatgaagagtta
aacttcttatctatcaaagccatactcaaatgtgaaattgatggatgttattatatagaa
acaacagaaacccaaaaggctgagcataaccgagaaattgaagaaatctgtcgtgaaaga
gaccaggcacaagctgatattaattctgtagaaacagcattttccgatcttcacaagaga
tatgaaaaacttaagggtttcgttgaaggctacagaaagaacgaggaaactttaaaggct
tgcatcgtagaatatcaacaaaaattgaaaaaaagcgaaaaacgttatcaaactttaaag
aatcatgctgaagagaaaattgatagcgctaacaaagaaataataaacgtccgaaaagga
cagcaggctgaattggcagctttgcaagccgctttacgtagggagcaggcgaaaaatgct
ggattggaaagtagcttaaaacagaaggcacaagagaacgcagaattaacatcgatatgt
gatgagctaattggaaagataggaaagtaa

DBGET integrated database retrieval system