KEGG   Trichoplax adhaerens: TRIADDRAFT_61894Help
Entry
TRIADDRAFT_61894  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
tad  Trichoplax adhaerens
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Wnt signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    TRIADDRAFT_61894
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    TRIADDRAFT_61894
   04070 Phosphatidylinositol signaling system
    TRIADDRAFT_61894
Enzymes [BR:tad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     TRIADDRAFT_61894
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1160 aa AA seqDB search
MTVIKTNFKVDSDGFFVSWTENKEGMCLDMFMINEAKNGTLPKDQRVRDLIEKECGPNVS
EARLLTIVYGYSLVDMKEIRLIASDAKSREIWKGGINKIIHDVISMNAPSDHFIKRSWVK
LCCTGDADGNIQVKNIYKLVPSKLEDRVVDSLKALNLPNKKNAVIDPSKFPFSTFMSLYN
KLCPRKDIEDIVMNRTGGKAPYLSIEQLRTFHNEEQRDPRLNELLYPFMKALQSKAIIDQ
YEPLEVLKGRGLITPEGLQYYFYSADSLIVPLEKLQLKAKDMDEPIAHYFINSSHNTYLV
GKQFGGKSVVDMYRNVLLAGCRCIELDCWDGKGQDEEPIITHGKAMCSDILFKDVIEVIK
EAAFIATDYPVILSFENHCSIKQQRKLAQYCLESFGDLLLTKPIDGYPTEPGKRLPPPSK
LRGKILIKNKKLIKTEQDTEKENAAASKDTANSPTKDSNGTITTNSQNGIKSDSAASDTK
KDGTDDAKPKINGSTTTKTTKGDSSEDPPAKKNLDPDVVAAVANYRYTGSTGNIDELLSS
VVIYTQPVPFPGFEEAKQRNLHYNMSSFNESTGFGHFKASPTDYVNYNKRQLSRIYPKGS
RVESSNFIPQIFWNAGSQMVSLNFQTPDLGFQLNQCKFEYNGMCGYLLKPEFMRRDDKQF
DPFAENPVDGIIAADLAVQVISGQFVSDRKVNTYVEVDMYGLPVDTVRKKFKTKTVYGNS
INPYYDSESFRFRKVIFPDLALVRFTVNDENGKMIAQRVIPFNAIQAGYRHVVLRNEWCN
PIGLAQLFCHFKMKTYVPEGLDEMVEMLSQPLKFLSILDERSKKMQVYDVDEDEDVSAVV
DETIEKAPSKDDSKPQTPAKPNAKATPKKSDSGSSSSNDSSSNESKAQMVRQTSAVGGML
DREPIKPVDIDELLKSKAFSKFFKKHQKEYHLVHKKHDKERFSAISQNLKQVNDLSMETF
GKKSFIENKTKEKKSRQKTGNPEADLKSKYIARVKSLKGSPSKDKINALVTKHISESTDI
AKRHEEDLQKFKNKASGIIWDQIKSLIINAFGDQIKNLEEQQKRDFAELRKGQAKRSMDD
TKKIVIDRSENTDKEDRTRRHRELSQYNVKQFMEERKKLCGRHDREKKQLEKKQEEEMRS
FESRKDEVNANQILYLNINR
NT seq 3483 nt NT seq  +upstreamnt  +downstreamnt
atgactgtcatcaagactaacttcaaggtagacagcgatggattttttgtctcatggaca
gaaaacaaggaagggatgtgcttggatatgtttatgatcaatgaagctaaaaatggcacg
ctaccaaaggatcagagagtccgtgatctaattgagaaggaatgtggccccaacgtctct
gaagcaagacttttaacaattgtttacggctactcgttagtagatatgaaagagatacgc
ttaatcgcttcagatgcaaaatctcgtgagatttggaaaggcggaattaataaaatcatt
cacgatgttatttcgatgaacgcaccatctgatcatttcataaagcgaagttgggtcaaa
ttatgctgtactggagatgcagatggtaatattcaagttaaaaacatctacaaattagta
cccagtaaactagaagatagggtagtagactctttaaaagccttaaacttgccaaacaaa
aagaatgctgttatcgatccgtcgaaatttccattttcgacatttatgtctttgtacaat
aaactgtgccctcggaaagatattgaagatatcgtcatgaatagaactggcggcaaggca
ccttacttatcaattgaacagttgaggacattccacaatgaagaacaacgcgatcctcga
ttaaacgaactattatatccatttatgaaagcactgcaatctaaggctataatagaccaa
tacgagccgttagaagttcttaaaggacgaggccttataacaccggagggcctgcaatat
tatttttacagtgctgatagcttgattgtaccattggaaaaattacaacttaaagctaaa
gatatggatgagcctatagcgcattatttcattaactcatcacataacacttatttagtc
gggaagcagtttggaggtaaatctgttgttgatatgtacagaaacgtccttttggctggc
tgtcgatgcatcgaactcgattgctgggatggcaaaggtcaggatgaggagccaattatc
acacatggtaaagcaatgtgttcagatatcctatttaaggatgtaattgaagttattaag
gaagccgcttttatagcaactgattatccagtcattttatcattcgaaaaccattgcagt
attaaacagcaacgaaagttagcgcaatattgcctagaaagttttggtgacttattactg
accaagcctatcgatggttatccgactgaaccaggcaaaagactgccacctcctagtaaa
cttagagggaagattttgataaagaacaagaaactaattaaaaccgagcaagataccgaa
aaggaaaacgctgcagcatcaaaagatacagcaaactctcctacaaaggattcgaatggt
accattactacgaattctcaaaacggtatcaaatctgattcagctgcctcagataccaag
aaagatggtactgatgacgcaaaacctaaaatcaatggctcaacaaccaccaaaacaact
aaaggggattcttctgaagatccacctgctaagaaaaatctcgatccagacgttgttgct
gctgtagcaaattatcgctatacagggtcgactggaaatattgatgaattactatcttcg
gtcgtgatttatacccaaccagtaccttttccaggatttgaagaagcgaaacagcgaaat
ctacattacaatatgtcttcatttaacgaatcaaccggatttggacacttcaaagcatca
ccaactgactatgttaactataataagagacaactgagtagaatttatccgaaaggcagt
agagttgaatcatctaactttatcccgcagattttctggaatgctggatcacagatggtg
tcgttgaactttcagactccggatttgggatttcaacttaatcaatgcaaatttgagtat
aacgggatgtgtggttacctgttgaaaccagaatttatgcgccgcgatgataaacaattc
gatccattcgccgaaaatccagttgatggaattattgctgctgatcttgccgtacaagtt
atttctggacagtttgtatctgatcgtaaagttaatacttacgtagaagttgatatgtat
ggcctgccggttgataccgtacgaaagaagttcaaaacgaaaacagtttatggcaacagt
attaatccttattacgacagtgaatcgtttcgatttagaaaggttatctttccagatctt
gctctagtaagatttaccgtcaacgatgaaaatggtaaaatgattgcacaaagggtaatt
ccattcaatgcaatccaagcaggctaccgccatgtagtgttacgtaatgaatggtgtaat
cctattggattagcgcaattattttgccactttaagatgaaaacttatgtccctgaagga
ttagacgaaatggtggagatgttatctcagcccttgaagtttttatcaatccttgatgaa
cgttctaagaaaatgcaagtttatgacgtggatgaggatgaagatgtaagtgcagttgtt
gacgaaacaatagaaaaagctccctcgaaggatgatagtaaaccacaaacgccggctaag
ccgaatgctaaagcaactcctaaaaaaagtgattctggatcatcaagctccaatgacagt
tcttcaaatgagagtaaggctcaaatggttcgccagacctcagcagttggtggtatgtta
gatcgagaaccaattaagccggttgacatagatgaattactaaaatctaaggctttctct
aaatttttcaaaaagcatcaaaaagaataccatctcgtccataaaaaacacgacaaagaa
agattttctgcaattagccaaaatctgaagcaagttaatgatttatcaatggaaactttc
ggtaagaaatcttttattgaaaacaagactaaagagaaaaaatctaggcagaaaacggga
aatcctgaagcagatttgaaaagtaaatatattgctcgagttaaatcacttaagggatct
ccttcgaaagacaagataaatgcattggttacgaagcacatcagtgaatcaacagatatt
gctaagcgccatgaagaggatttacagaaatttaaaaataaagcttcaggcattatttgg
gatcaaattaaatcgcttataataaatgcttttggtgatcaaataaaaaatttagaagaa
caacaaaagcgagactttgcggaattaagaaaaggtcaagcgaagcgatctatggatgat
accaaaaaaattgtgattgatcgatcagagaacacggacaaagaagatagaactaggcgc
catcgtgagctcagtcaatacaatgttaaacagttcatggaggaaaggaaaaagttatgc
ggcaggcatgatcgtgaaaagaagcaattggaaaagaaacaagaagaagagatgcgatct
ttcgagagtcgaaaagatgaagtaaatgcaaatcaaatattgtaccttaatattaacaga
tga

DBGET integrated database retrieval system