KEGG   Trichoplax adhaerens: TRIADDRAFT_62057Help
Entry
TRIADDRAFT_62057  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K03099  
son of sevenless
Organism
tad  Trichoplax adhaerens
Pathway
FoxO signaling pathway
Dorso-ventral axis formation
Jak-STAT signaling pathway
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:tad04630]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:tad04068]
Organismal Systems; Development; Dorso-ventral axis formation [PATH:tad04320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1171 aa AA seqDB search
MEWYEQDDTLARLKGCFRTLYRKALENAIPDLTIADEGLEHLDKLMIRLLVIICACLPHT
VADVEEYILDTFPNPIDESVISEARGMLEKGKKRSHLSACVDKFHSVLQKDILCYKIDQQ
LSLYVITVADYLICNILKLTGTYIRNIKHTEIGSQDIKIAMFANNPLQELFNRDVDQIHE
EMGRDTFIPYETLVKELLLEEQQFIRDLNLITKIFREPFITAAHLFSEREVQRLFSNVDD
IYEFSVSFLGLLEDTIEMADNDTEQYTQVGDCFLEMAEAEEFSVYDTYCTSLRESSKVWS
NILQKPEVLTYCQYIGAKYKFKFKEGVQYILPKLLIVPIQHCLKYFDFIDLLAGVTVHQE
DHDNLEQALGILRTLQIQIKKTCDTLIGKRRHYGDAFECLLRPSRRRTPMHMLYELEEAI
DAWERVYCIKCHLEKSAMDRTLDGLLQEQENATILRLPDPKHYRFAIPDKVGTDGNIVLE
ENKYNPSGVPLVKGGTILKLVERLTYHKYSGLNYQDFSATVRDEYKKFKKEYLEPVQLRV
LNVLRQWVDHHFYDFAKDEILLDRLKEMVESKKGKSMRKWIESIVKIINRKEQEIYFSIA
SDTSPTFDFSPPPIEWYIARKSDQYSILTLHPVEIARQLTLIESELFRAVKPSELVGVMW
TKPDKDKLAPNVLQLIQHSTLITHWCENEILKHENLEERTAVVLRFIEVLMVFEELNNLN
GILEIASAIGSSPVHRLEHTFKEIPPKRLSYLKEMLGLTADHFRKYNEKLRSVNPPCIPF
MGKYLTEILHTEEGNPDFLPTSSSETIINFHKRRKVADIVGEIQQFQNVPYCLREEPSIK
RFLTSLDPTETKSKSQFEDYLYEQSLKVEPRDKTDPPKFSRRTDVPLKSPGIKIRSNSLT
GMGIMTSNPIATRRTSGSGGRDSIRSFSEAVNQGSLASKKRTLSRSRGSNFEFLTSTSQP
DAFLGRGAVRSLSLPIDPNIKLLKGNRIRTVSNSSIASTEPITLFENEYESSNEIIPPVP
PRKSRSASSSDIHRLEVVEDKHEVLTRHLSFRGHPSGDSRLPLPIQEEVIFDENDQQDKP
PPLPPKPRQLFIESTNPQKADDTGVPPPLPPRDFSSTPCANTFFNVHFMDNGDVDGNDVD
KAPLPPPRLLNRSTSKTDEPPPPLPPRPAKA
NT seq 3516 nt NT seq  +upstreamnt  +downstreamnt
atggagtggtatgaacaggacgataccttagccagattgaaaggttgctttcgaacgctg
tatcgcaaggcgttggaaaatgcaatccctgacttaacgattgccgacgaaggattagag
catttagacaaactaatgatacgattgcttgttataatatgcgcttgtttaccgcatacc
gtagccgatgtggaagagtatatattggacacttttcctaacccaatcgatgaatcagta
attagtgaagctagagggatgttagaaaaaggaaagaaaagaagtcatctatcggcctgc
gttgataagttccattcagtccttcaaaaggatatcctttgctataagatagatcagcaa
ttatccttatatgttataaccgtagcggattacttaatatgtaatatattgaagctgact
ggtacgtacatcagaaatataaaacatacagaaattggcagtcaagatattaaaatcgcg
atgtttgctaataatccgttgcaagaattatttaaccgtgacgttgaccaaatacatgag
gaaatgggtcgagacacctttattccttacgaaacattggtaaaagagttacttttagag
gagcaacagtttattcgggatttaaaccttattacaaagatatttagagaaccatttatt
accgcggctcatctgttttctgaaagggaggtacagcggttattttccaacgttgatgac
atttacgaattttccgtaagcttccttggattattggaagatacgattgaaatggcggac
aatgatacggaacaatatactcaagttggtgattgctttttagaaatggctgaggctgaa
gagtttagcgtgtatgatacttattgtacatccttaagggaatcttcaaaagtttggtca
aatatattacagaaaccggaagtattaacttattgtcagtatattggagccaaatataaa
tttaaatttaaggaaggagtacaatacatactgccgaaattgttaatagtacctattcag
cactgcttaaagtactttgacttcattgatctcttagcaggagtaacagtccatcaagaa
gatcatgataatcttgaacaggctttgggaattctaagaactctgcagatccaaattaaa
aaaacatgtgatacgttaatcggaaaaaggagacattatggggatgcatttgagtgtttg
ttgcgtcctagcagacggagaacgccaatgcatatgctttacgagctcgaggaagcaata
gatgcgtgggagagggtatactgtataaaatgtcatctggaaaaaagtgccatggatcgg
actctggatggcttattacaagaacaagaaaatgcaaccatacttagacttccggatcct
aagcattacagatttgctatacccgacaaagttggaactgatggcaatattgtattggag
gagaataaatataatccatccggtgtgccattagtaaagggtggaactattttaaaatta
gttgaaaggctaacatatcataaatattcaggattgaattaccaagactttagtgctacc
gttagggatgaatataaaaagtttaaaaaggaatacctagaaccagtacaactacgagta
ctgaatgttttacgtcaatgggtcgaccatcatttttacgactttgccaaagatgagata
cttttagatagattgaaagaaatggttgagtcaaagaaaggtaaatcaatgcgaaaatgg
atcgaatcgatagtaaagatcataaatcgtaaggaacaggaaatctacttcagtattgcg
tccgatacttctccaacatttgatttttcgcctccaccgatagaatggtatattgctcga
aaatcggatcaatactccattcttacgcttcatccggtagaaatagctcgtcaactgaca
cttatagagtcggaattatttagggctgttaaaccctctgaattggttggtgttatgtgg
acaaagcctgataaggacaaattagctccaaacgttttgcaactcattcagcactcgaca
ttgattacgcattggtgcgaaaatgaaattttaaagcatgaaaatttagaagagagaaca
gcagtagttttgagattcattgaagtactaatggttttcgaggagttgaataatttaaat
gggatacttgagattgctagcgcaataggttcgtcgcctgttcacagattagagcatact
ttcaaggaaattccgcctaagcgactttcttatttaaaggaaatgcttggacttacagct
gatcatttccgaaagtataatgagaaattgcgctccgtaaatccgccatgtattccgttt
atgggaaaatatttaacagaaattcttcataccgaagaaggaaatcctgattttttaccg
actagctcatcggaaactataattaattttcataaaaggcgtaaagtcgcagatattgtt
ggtgaaattcagcaatttcagaatgttccatattgtctgagagaagaacccagtatcaaa
cgatttttgacatccttggatccgaccgaaacaaaaagtaaaagccaatttgaggattat
ttatacgaacagtctttgaaagttgaacctcgtgataagaccgatcctccgaaatttagt
cgtcgaactgatgtacctttaaagtctcctggtattaagattcgatcaaactctttaact
ggtatgggtattatgacatccaacccaatagctaccagaagaacaagcggtagtggcggc
agagattctatcagatcattttcggaagctgtcaatcaaggctctttagcttcaaaaaag
cgtactcttagccgtagtagaggttcaaatttcgaatttcttacaagcacttctcaacca
gacgctttcttaggaagaggggcggttcgatcattatcattgcctattgatccaaacata
aagttactgaagggaaatagaatcagaaccgtttcgaactcatcaatagcgtcaacagaa
ccaattacgttgtttgaaaatgaatacgagtctagcaatgaaattattccgccagttccg
ccgcggaaaagtcgatcagcttcatcaagtgacatccatagattagaagttgtcgaagat
aagcatgaagtactgactcgccatttatctttccgtggccacccaagtggtgattcaaga
ctgccgctcccaattcaagaagaggtaatatttgatgaaaatgatcagcaggacaaaccg
cctccgttgccacctaaaccgcgacaactatttattgaatcgactaatccacagaaagcc
gatgatactggagtaccaccacctttaccgccgagagatttttcatctacaccatgcgct
aacacattttttaatgttcatttcatggataatggtgatgttgatggaaatgatgtagat
aaggctccacttccaccaccacgattgcttaatcgaagcacatcaaaaactgatgaacca
ccaccaccattaccaccacggcctgctaaggcataa

DBGET integrated database retrieval system