KEGG   Trichoplax adhaerens: TRIADDRAFT_62084Help
Entry
TRIADDRAFT_62084  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K04437  
filamin
Organism
tad  Trichoplax adhaerens
Brite
Exosome [BR:tad04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   TRIADDRAFT_62084
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 3834 aa AA seqDB search
MTSRKKNQDIREDETPIEMLENMAEDAEWKRIQKNTFTRWCNQHLKTRNLQINDLFKDFA
DGLKLIALLEILSGRIIKGYHRKISFPQHKIENVSTALRFVESLGISLISIDSGHIIHGN
SKLILGLIWKLILHFQISLPTIQPALRKVPEDVITADNMQNNQANPMNQPPSPVEKPQKV
SAKQALLNWVNDVLPKDYKVNNFTRDWNDGIAIQALVDNIAPGLCPEYETANPHNALENA
TVAMERASDCLDVPMVLTPEDMVNPKVDEKSVMTYVSFFPEAKLKPGVKLPGDCDPTKVK
VKGRGIQPTGLLAHEKAEFIVDTRGAGEAELEIAVVDPNGRDVDLSQVEDNGDGTYTIAY
NPTIDGNYVIDVIFYGQHVPKSPFHVEVQSFCDPNRVRTEGPGLASTGVVAGEFTYFNVL
TKGAGSGEVAVEVFDSHGASDYIEIAMEKVNENVFKVEYKPLNSGLHTVKIFFGGKPVRG
NPHRIHVQQGVDPSRVRVHGPGIEPRGVIINRSTQFTVDTSEAGDANLEIVIENSKGRKL
RPVIEHNEEELVNTVSYTPTTNGMHRVTIRYANEDIPGSPYEVDVASKDELDIIKVYGRG
LHHAVVNKNAYFTIETLKETTQPMSLHIEGPSEATVECYEDDNAKCDVAYVASAPGQYSI
HILFGEKEYIESPYLADMVPAFCDPSKCNASGPGLDRTGLLSGTETEFIVDTSEAGLGEL
MIAIQDSKGNELDVDIIDNRDDTFTAKYTPVDPDRYRISIHYGNQPIPRSPFRVKVDPSW
DASKCKANGPGIAPVGVKAMEVTHFNVDATKAGVAELMVEISQQTGGTKSQELLADIIDN
NDGTFTVEFTPPKPGRYTVVVKYGDAHIPDSPYRIKVDKGYDASKCHAEGLGIERRGNHV
GQRTEFQIDTIQAGQGELTLNFEGFVINASDPYNSESPYDVDVVTNDNQCYAVSYTPIDE
GQLTISVLYGADDIPGSPFRVIVAPGIDPSKCLAQGPGLAPTGVVTKYQAHFEIFTDGAG
PGELAVVVEGPSGDVDPEIEAKNDVHTDFAVNYIPNEEGMHTVTILFGGVNIPGSPFNIN
VGPHADASKCYGSGPGLQNTGLQANQATYFEVDTADAGIGDLEIDIKDEDNQDVVATIKD
NEDGTYLVNYRPLEPGKYVVSVIYADDHIPSSPYFVNVAKGKDFSGVQIYGRGLRRGVVD
KYAYFTVKTEIDLTDPMSFAVEGPAEATINCTDNGDHTCTVSYVADVEGTYSIHVFFGDE
EYPHSPYFPKIEPAFCDPSKCTAKGPGLNRTGLKTGYPADFTVDTSEAGLGDLMIIVEDV
RGIEAEVSIVDNRDDTFTVTYTPTAPEYYVITILFGNQPIPRSPYRVRVDPSWDASKCIA
TGPGIEPASVKALEETYFEIDATDAGTAELSAEVINHVGPRNNQDIAPDIINNEDGTFLV
RFLPPNPGRYTINVRYGDKHIPDSPYLITVGKGYDASQCVAEGQGLERKGNHVGKATEFY
VHTSGAGIADLTLNFEGYVIHADDPLTSDSPYNVDVYRDNEDVYVISYTPYSEGRLIISV
LYGSDDIPDSPFRVNIGPGIDPSKCLAQGDGLTPNGVVTEHDSEFEVFTDGAGPGELTVI
VDGPGGEVVPEIEQENDTDYQVTYAPTEIGMHSVSVLFSGVHIPGSPFDVNVSPHADPSK
CLGSGPGLERYGLIANKVTYFEVDTVEAGAGVLKIIIEDQDRNEIDCQMKPDADGTYVIN
YRPIEPGEYNISVLYDDEHIPDSPYIVNVEKGKDFSGIQIYGRGLRRGVVDKYAYFKVKT
ETELTDPMSFSIEGPAETGIECSDTHENVCTVSYVAPVEGTYKIHVYFGDEEYPQSPYSP
VIEAAFCDPSKCTAKGPGLERTGLKSGYPADFIVDTSEAGLGDLMIIVEDVKGNEADVSI
VDNRDDTFTVTYTPWVPDFYIITIIFGGENIPRSPYRVRVDPSWDASKCTADGPGIEPAG
VKALQETYISVDASEAGMADLTVDVVNQLQSRQNQEIISEIIENGDGTFTVKYTPPIPGR
YSVIIKYGDDHIPESPYNVRVEKAYDASLVHASGPGLERTGLHSGLRTEFIVDCTEAGIA
ELSCDFEGHIVQASHPQSSVNPYDVDIIDNSDGTYLVEYTPCEQGRLTVIIMYGADDIPG
SPFKVNVGPGIDPSKCFALGPGLEPGVRVGFATSFEVSVEGAGPGQLTLDIVDPNNNAVD
YDLEDTSDIDYNVDYTAQIEGPHQVNIYFAGVHIPNSPFTVDVGPYSDPSKCKAFGPGLV
SGFVGASTDFTIDTTEAGDGDIGVTIDGPTEAEIDSLDNGDGTCSVNYFPILPGQYTINI
LFASEAIPNSPFVATIVYPVDASKCIVGGPGLENGLIEDEATYLTVDTTMAGDAQLKIDL
EDADGHHIPLVVKENEDIFTAEYSTTVAGPMTANISYGDQPVPGSPFTINVDHRVDVSKI
IVSGNGLENPVYVGEESKFTVDAIDAGPSQLDVYIQSTTGVYVEAAIEQDPELIFNVTYV
APSEGDYVIDIKYHNEDVPDNPFSVFAELPLDPSKVSAYGPGLEGAITDIATAFIIDTRE
AGYGNLDISVDGPVDAPLTCNELGDGRCEVTYTPPRRGVYEFHITYGDEAIPGSPFPVNV
ANPLDPSKCVASGPGIEKTGNRAQHETNFIVDTSEAGDAELEVDIKTQSGHHIDNKITHN
SEGIYNVSYTPKNEGLCYIKVKYAGKEIPRSPFSTRILPAYDASKVNVEGDCLNGEPVYV
EDEQCVHVDYSEAGLGDLTALLKAPNNRKLAPEILDNGDDTSDIRFVPEKVGRYQLTIKF
GADHVPGSPFQVSAAPFAFPEKCVASGTGLDRTGNKTGTRQKFLIDAKEAGRGNLTASLI
TPRGYEFPIPLEEHEDEPGVFSCRYRYFEQGRNKVNVKFADHDIPGSPFPVKVDKGYATN
PERVDIGNADEVEAKLVTVDEIIPIEVDATKAGPGDLDAQVKCPSGAIIDPEVIDNDDDT
YRVSFKSDEIGVHEVSIKYANQHVHGSPFNVVIYGPGAADCKAYGNGLDEATVGEEATFT
IDSKDAGTGSLAVDIEGPEEADIISEDNGDGTCDVNFVPTAPGNYDIHVTFNGNPIPGSP
FPCNVTPKPIIEESVGKDQAPTAEDSPINWDDLDDLSENPYKPETPLDVINEAVTMEQVK
TTQLEQLCDFLLENPDRDVRDLNATVISPSGNTQPCKLVPKRDGTFGVNFVPHELGRHHV
NIIKHGKHIDGSPFIVDVLPMDYCDPTKVYATGTGLVSGVVNQEAEFMVNTRDAGYGGLG
VDIHGPSQAELTCIDNQDGTCTFKYTPTVPGYYGIEIKFADQHIPGSLFYPYIAPDRQAK
QTFRQVFAQVTEQPDTKTEVGKSLGFAFQLPNARRENIAASVRQPSGFVYEAEIVEESPE
LYTVQFLPKEPGDHLVSIKKNNRHIQGSPFPVSVRFGGDSREVKCFAYGPGLQYGFVNRQ
SHFTVWTTDKTAESFRVEIEGPSPLEIFCHDNDDTSHVLSYTPPVPGEYLIHVIFRDKEI
PHSPYTVHVMSDESEVKPVNENIQRAEAAVGEASLFELPDDIAGEELDVTIISPSGIKEP
GSVTRTERGSYIARFVPIEPGKHTVNMTVNGRHIPGSPFYVYVNPDGGDAKQCKAYGKGL
KYAKVSEVAEFYVLTENAGPGEVDISIDGPVKTGCNHKVTTPGHHTATYLPLADGIYTIN
IKFAGKHVPYSPFRVPIRDADKPKPEKCIAEGPGLQSARKGVNHFTLDASDAGNGSIMVG
VKGPSIPCDEIKVNHKGDKVYTVGYRLAESGPHLLTVKWGDKHIPGSPYTVIAK
NT seq 11505 nt NT seq  +upstreamnt  +downstreamnt
atgacttctcgcaagaaaaatcaagatatcagagaggatgaaacaccaattgaaatgttg
gagaatatggccgaagatgcggaatggaaaagaattcaaaaaaatacttttacaagatgg
tgtaaccaacacttgaaaactcgcaacttgcaaattaatgatttatttaaagattttgct
gatggattgaaactaattgctttattggaaatactatcggggagaatcatcaaaggctac
catcgaaagattagttttcctcagcataaaattgaaaatgtttcaacggctttacgcttt
gttgaaagtcttggtatttcactcatcagtatagatagtggccatatcatccatggtaat
agtaaactgatactgggattaatatggaagctgattttacattttcaaatttctctacct
accattcagccggcacttcgcaaggtgcctgaagacgtcattactgctgataatatgcaa
aataatcaagctaatccaatgaatcagccaccatcaccagtagaaaaacctcaaaaagtc
agtgctaaacaagccctactaaattgggtcaacgatgtccttcctaaagactataaagtg
aacaattttactagggattggaatgatggaattgctattcaagccttagtggacaatatt
gcgcctggcttgtgtccagaatacgaaactgctaatccacacaatgcccttgaaaatgct
accgttgcaatggagagagcatcagactgcttggatgtacccatggtactaacaccagaa
gatatggttaatcccaaggtagatgaaaaaagtgttatgacatatgtatcattttttcca
gaagctaaattgaaacctggcgttaaattacctggtgattgcgatccaacgaaagttaaa
gttaaaggtcgtggcattcagccaactggtctattagcacatgaaaaagctgagttcatt
gtcgatacgcgtggcgctggtgaagccgaattggagattgccgttgttgatccaaatgga
cgagatgttgatttaagtcaagtcgaagataatggagatggaacgtatactatcgcttac
aatccgaccattgacggtaattacgttattgatgtaatattttacggtcaacatgtgcca
aagagcccgttccatgtagaagtgcagtcattttgcgatcctaatcgagttcgcactgaa
ggaccaggattagcttcaactggtgttgttgcaggcgaatttacatactttaatgtgcta
actaaaggtgctggctctggtgaagtagcagtggaagtcttcgattctcatggagcatct
gattacattgaaattgctatggaaaaagttaacgaaaatgtatttaaagttgaatacaaa
ccattaaattctggtctacatactgttaaaattttttttggtggcaagccagttcgcggt
aatccacatcgcattcatgttcaacaaggtgttgatcccagtcgcgtccgtgttcatggg
cctggtatcgaacctcgcggtgttattattaacagaagcacacaatttaccgttgatact
tcggaagcgggcgatgctaatcttgagatcgtgatagaaaatagtaaaggtcgtaaattg
cggcctgtaatcgaacataacgaagaggaactagtcaatacagtcagctatacaccaact
actaatggaatgcatcgtgtcactatcagatacgccaatgaagatattcctggtagtccg
tatgaagtggatgttgcttctaaagatgaattagatataattaaagtctatgggcgagga
ttgcatcacgcagtagttaataaaaatgcctattttacaattgaaactttaaaagaaact
actcaacctatgagtttacatattgaaggcccttctgaggcaacggttgaatgttatgaa
gatgataatgccaaatgcgatgttgcttacgttgcttcagcacctggccagtactcgatt
cacatcctatttggtgagaaagaatacattgaaagcccttaccttgctgatatggtccca
gcattttgtgatcctagtaaatgtaacgccagtggacctggtttagataggactgggttg
ctatcgggtaccgaaactgaatttattgttgatactagtgaagctggtctaggtgaatta
atgatcgcaatccaagattctaaaggaaatgaacttgatgtagacatcattgacaacaga
gacgatacttttaccgcgaagtatacgcctgttgatcccgacagatacagaatatctatc
cattatggtaatcaaccaattccgagaagtccatttcgtgtcaaagttgatcctagttgg
gatgcatccaagtgtaaagccaatggtcctggtattgcaccggtgggcgttaaagctatg
gaagtaacccattttaatgttgacgcaactaaagctggtgttgcagaattaatggttgaa
atcagtcagcaaaccggtggcactaaatcgcaagaactacttgctgatattattgataat
aatgatggtacatttacagttgaattcacaccgccaaagcctggtaggtatactgttgtt
gtaaaatacggtgatgcacatatacccgatagtccgtatcgtattaaagtcgataaaggt
tacgacgctagtaaatgtcatgccgaaggccttggtattgaaagaagaggtaatcatgtt
ggtcaacgaaccgaatttcaaattgatacaatccaagctggacaaggagagttaacgctt
aactttgaaggattcgttattaatgctagcgatccctataattcagagagcccttatgat
gttgacgttgtgacaaacgataaccaatgctatgctgtatcgtatacacctattgatgaa
ggacagttaacaatctctgtcctatacggtgccgatgatataccaggcagtccatttcgg
gtcattgttgcgcctggaattgatccaagtaaatgtctagcacaaggtcccggcttagca
ccaactggagttgtaacgaaatatcaagctcattttgagatttttactgatggtgctggt
cctggtgaattagcagttgttgtagaagggccatctggtgacgtagatcctgaaattgaa
gctaaaaatgatgttcataccgattttgctgtcaattatatacctaatgaggaaggtatg
catactgtaacgatcctttttggtggtgttaatattcctggtagcccattcaatattaac
gttggacctcatgctgatgcaagtaaatgttacggtagtggtccaggtttacaaaatacc
ggtctgcaagcaaatcaagcgacatattttgaagtagatacagctgatgctggcataggt
gatttagaaatcgatattaaggatgaagataatcaagatgtagttgcgacaattaaagat
aatgaagatggtacctatttagttaattatcgcccattggagccgggtaaatacgtcgta
tccgtaatctatgccgatgatcatattcctagtagcccgtactttgttaatgtcgctaaa
ggtaaagattttagtggcgttcaaatttatggtcgtggtttacgtcgtggtgtcgtggat
aaatacgcttactttacggttaaaacagaaattgatctcactgatccaatgagctttgct
gttgaaggccccgccgaagctacaatcaattgtacggataatggtgatcatacttgtact
gtttcttatgttgctgatgttgaaggaacatattctattcatgttttcttcggcgatgag
gaatatccacatagtccctactttccaaaaattgagcctgcattttgcgatcctagtaaa
tgtactgccaaaggaccaggattaaatcgaactggccttaagaccggctaccctgctgat
tttactgttgacactagcgaagctggacttggagatttaatgatcattgtcgaagatgtt
agaggaatcgaggctgaagttagtattgttgacaatcgcgatgacacttttactgttaca
tatacaccgactgcaccagaatactacgttattaccattctatttggtaatcaacccata
ccacgtagtccttacagagttagagtagatcctagctgggacgcttcgaaatgtattgca
accggcccaggtattgaaccagctagtgttaaagcacttgaagagacctacttcgagata
gatgcaactgacgctggtactgctgaattatcggcagaagttatcaatcatgttggacca
agaaataaccaagatatcgctcctgatattattaacaacgaagatggaacatttttagtt
cgatttttaccacctaatcctggtcgttacactattaatgttagatatggtgataaacat
ataccagatagtccatatcttatcaccgtcggcaaaggttatgatgcatcacagtgtgtt
gcggaaggtcaaggcttggaaagaaagggaaatcatgtcggtaaagcgacagaattttac
gtccatacctcaggtgctggtattgctgaccttacgttaaactttgaaggttacgttatc
catgctgacgatcctttaacttcagattcaccgtataatgttgatgtttatcgagataat
gaagacgtgtatgttatatcatatacaccgtacagtgaaggcagattaattatatcggtt
ttatacggttctgatgatattcctgacagtccatttagggttaatattggccctggtatc
gatccgagtaaatgtttagctcaaggtgatggcctaacacctaacggcgtagttactgag
catgattcagaatttgaagtttttactgatggtgctgggccaggtgaattgacggtcatt
gttgatggcccaggtggagaagtagttccagaaattgaacaagaaaatgatacggattat
caagttacttatgctcccaccgaaatcggaatgcatagtgttagtgttctctttagtggt
gtccatatacctggtagtccttttgatgttaatgtcagtcctcacgctgatccaagtaaa
tgcttaggaagtggacctggtttagaacgttatggactaatcgccaataaagtcacatat
ttcgaagtggacactgtagaagctggtgctggtgttcttaaaattataattgaagatcaa
gacagaaatgagatagattgtcaaatgaaaccggatgctgatggtacatatgtaattaat
tatcgtcctattgaacctggcgaatacaatatatctgtattgtatgatgacgagcatata
ccagatagcccatatattgttaacgttgaaaaaggtaaagattttagtggtatacaaatt
tacggacgtggtttacgccgaggtgttgtcgataagtatgcatattttaaagtaaaaact
gaaacggaattaacagatccaatgagtttctctattgaaggcccggctgaaactggaatc
gaatgctcggatactcacgaaaatgtttgtacagtttcatatgttgcccctgttgaaggt
acttacaagattcatgtctattttggtgatgaggaatatccgcaaagtccttactctcca
gtaatcgaggcagctttttgcgatcctagtaaatgtacagccaaaggtccaggcttagaa
agaaccggcttgaagtccggttatccagctgatttcatagtcgatacaagcgaagctgga
ttaggggatttgatgattatcgtcgaggatgtcaagggtaatgaagccgatgttagtatt
gtcgataatcgcgatgatacctttaccgttacttatacaccatgggtacccgatttttac
attattaccataatatttggtggtgagaatatccctcgaagtccatatcgggttagagtt
gatccaagttgggatgcatctaagtgcactgcagatggtcctggtattgaaccagccggg
gttaaagccttacaagaaacttatatatcggtcgatgcatctgaggctggtatggcggac
ctaactgtagacgtagttaatcaattgcagtcacgccaaaatcaggaaataatatctgaa
atcatcgaaaacggcgatggtacttttactgtgaagtatacacccccaattccagggcgt
tactcagttattataaaatatggtgatgatcacataccagagagtccatataacgttagg
gtcgaaaaagcctatgatgcatccttagtgcatgctagtggtcctggtttggaaagaact
ggcttacattctggactccgaacagaatttatagttgattgtaccgaagctggcatagct
gaattatcgtgtgactttgaaggtcatattgtgcaggctagtcatccgcaatcatcagta
aacccatatgatgttgatattattgataattcagatggtacatatcttgtggagtataca
ccatgtgagcaaggccgtctaacagtcattattatgtacggtgctgatgacattcctggt
agtccattcaaagtaaatgttggccctggtatcgatccgtctaaatgctttgctttaggt
cctggcctcgagccaggtgtacgagttggatttgctacatcttttgaagttagtgttgaa
ggagctggtccaggtcaattaactctcgatattgttgatccgaataataatgccgttgat
tatgatctagaagatacaagcgacatagactacaacgtggattatacagcacaaattgaa
ggtcctcatcaagtaaatatttactttgctggcgttcatataccaaacagtccattcaca
gtcgatgttgggccttatagtgatccatcaaaatgtaaagcatttggaccgggtcttgtt
agtggatttgtaggtgcatccacagattttacaatcgataccactgaagctggtgatggt
gatatcggagttactatcgatggacctactgaagccgaaattgattcacttgataacgga
gatggtacatgttctgtaaattattttcccatattaccaggccaatacacaatcaatatt
ctgtttgctagcgaagcaatacccaatagtccttttgtcgctactattgtttaccctgtg
gatgcttcaaaatgtattgttggtgggccaggtttagaaaatggtttaattgaagatgaa
gcaacctatcttaccgtagatacaacaatggctggagatgctcaattaaaaattgaccta
gaagatgctgatggccatcatattccgttagtagtcaaggaaaatgaggacatttttaca
gctgagtattctacaacagtagctggacctatgacagccaatattagttacggcgatcaa
cctgttccaggtagtccatttacgattaatgttgatcatcgcgtagacgtttcgaaaatc
atcgtatcaggtaatggattggaaaacccagtttatgttggtgaagaaagtaagtttacc
gtagatgcaattgatgctggaccatcacagctcgatgtttacatccaaagtacaactggt
gtttatgttgaagcagcaattgaacaggatccagaattgatctttaatgtcacgtatgtt
gctccaagtgagggtgactatgttatcgatataaagtatcacaatgaagacgtgcctgat
aacccatttagtgtttttgcggagttgccactggatccatcgaaagtatcagcttatggt
cctggtctagaaggtgctataactgatattgcaactgccttcattatcgatactagggaa
gccgggtatggtaatcttgatatatctgtagatggcccagttgatgcaccattaacttgc
aacgaattaggtgatggaaggtgcgaagtaacttatacacctcctcgtcgtggcgtttat
gaatttcacataacttatggtgatgaagcgattcctggtagtccatttccagttaatgtg
gctaacccacttgatccaagtaaatgtgttgcatctggccctggtattgaaaaaactgga
aatcgcgctcaacatgaaactaattttattgtagatacctctgaagctggtgatgctgaa
ttagaagttgacatcaaaactcaatctggtcatcatattgataataagataactcataac
agtgaaggtatttataacgtgagttatacgcctaaaaatgaaggtctttgttacattaag
gtcaagtacgctggcaaagagataccacgtagtccctttagtactcgcattttgccagct
tacgatgcaagtaaagtcaatgttgaaggtgattgcttaaacggtgagccagtgtatgtt
gaagatgagcaatgcgttcatgtggactattcagaagcaggcttaggtgatcttacagcg
ttattaaaagcgccaaataatagaaaacttgcacctgaaatattagataatggagatgat
acatctgatatacggtttgtgcctgaaaaagttggtagatatcagctaacgattaagttt
ggtgctgatcatgtaccaggtagccctttccaagtttcagcagccccttttgcatttcct
gaaaagtgtgttgcatcgggtactggcttggatcgtacaggaaataaaactggtacgcgc
caaaaattcctcattgatgcaaaggaagcaggtcgtggtaatttaactgctagcctcata
actcctcgtggttatgaattcccaatacccttagaagaacatgaagatgaaccaggtgtt
ttttcttgccgatatcgatatttcgagcaaggccgtaacaaagttaacgtcaaatttgca
gaccacgacattcctggcagtccgtttcctgttaaagttgataaggggtatgcgactaat
cctgagcgtgttgatattggtaatgctgatgaggttgaagctaaattagttacggtagat
gagataataccgattgaagttgacgctactaaagcaggtcctggtgatctagacgctcaa
gttaaatgcccgtctggagcaataatagatcccgaggttattgataatgatgatgacact
tacagagtcagttttaagtcggatgaaataggtgtccatgaagtcagtatcaagtatgca
aatcagcatgtgcatggtagtccatttaatgttgtaatctatggacctggtgctgctgac
tgtaaagcgtatggtaatgggctggatgaagctaccgttggcgaagaggcaacatttact
attgacagcaaagatgctggtactggtagcttagcagttgatattgaaggaccggaagaa
gctgacataatttctgaagataacggtgatggtacatgtgacgtcaattttgtaccaacg
gcgcctggtaactatgatattcatgttaccttcaatggtaatccgattccaggtagtcca
tttccttgtaatgttacacccaagcctattatagaagaaagtgttggtaaagatcaagca
ccaactgctgaagatagcccaattaactgggacgatttagatgatctatctgaaaaccca
tacaagcctgaaacaccacttgatgttatcaatgaagctgttacaatggaacaagtgaag
acaacgcagttggagcaactatgcgatttcttactagaaaatcctgatcgagatgttaga
gatcttaatgcaaccgtcattagcccatccggaaatacacaaccatgcaagctagttcca
aagcgcgatggtacgtttggtgtaaattttgtacctcacgagcttggacgtcatcatgtc
aatataataaagcatggcaaacatatcgatggtagtccattcattgtcgatgttcttcca
atggattactgtgatccgacgaaagtctacgctactggtacaggtcttgtaagtggagtt
gttaatcaagaagctgaatttatggttaatacccgtgatgctggctacggtggactgggt
gtagatatacatgggccatcgcaggctgaattaacttgcattgataaccaagacggtaca
tgcacattcaaatatacaccaactgttcctggatattatggtattgaaattaaatttgct
gatcaacatatacccggtagcttgttttatccgtatattgcacctgacagacaagctaaa
caaacatttcgacaagtttttgctcaagtaaccgagcaacccgatactaaaactgaagtt
ggtaaatcgttaggattcgcatttcaattacctaacgcaaggcgtgagaatatagcggct
tcagttcgacaaccatctggattcgtttatgaagctgaaattgtcgaagaatcacctgaa
ttgtacacagttcaattcttgcccaaagagccaggtgatcatttggttagtataaagaaa
aataatcgccatattcaaggtagtccatttccagttagcgttcgatttggtggcgacagt
cgagaagtcaaatgttttgcttacggtccgggtctacaatatggtttcgttaatcgtcaa
agccactttactgtgtggacaactgataaaacggccgaaagtttcagagttgaaattgag
ggaccatcacctcttgagatattttgccatgataatgatgatacatcacatgtgctatcg
tatacaccaccagtgccaggcgagtatctcatccatgtcatattccgcgataaagaaata
ccgcacagtccatacactgttcacgttatgagcgatgaaagtgaggtaaaacctgtaaat
gaaaatattcaacgagctgaggccgcggttggtgaagcttcattatttgaattaccggat
gacattgcaggtgaagaacttgacgtaacaattatatcaccatcgggcataaaagaacct
ggtagcgttactcgtactgaaagaggtagctatatagctcgattcgtacccattgagcct
ggcaagcatactgttaatatgacggtaaatgggcgccacatacctggtagcccgttctat
gtctatgtaaatcctgatggtggggatgcaaagcaatgtaaagcatacggtaaagggctg
aaatacgctaaggtatcggaagtagcagagttttatgttttaaccgaaaatgccggccct
ggtgaagttgatattagtattgatggaccagttaaaacaggatgtaatcataaagtgacc
acacctggtcatcatacggcaacttatcttccattagcagatggcatttatactattaat
attaaatttgctggcaagcatgtcccttacagtccgtttagagtcccaataagggatgct
gataaacctaaacctgagaaatgtattgctgaaggacctggtcttcaatctgcgcggaaa
ggtgttaatcattttactttagacgcctctgatgctggtaacggttctatcatggttgga
gtaaaaggacccagtattccgtgtgatgaaattaaagttaaccataaaggtgataaagtt
tatacagttggttatcgactggctgaatctggtcctcacttattaactgttaaatggggt
gataaacacattcctggtagtccgtatacagtaattgctaaataa

DBGET integrated database retrieval system