KEGG   Trichoplax adhaerens: TRIADDRAFT_6279Help
Entry
TRIADDRAFT_6279   CDS       T01069                                 

Definition
protein kinase Ck2-beta
Orthology
K03115  
casein kinase II subunit beta
Organism
tad  Trichoplax adhaerens
Pathway
Ribosome biogenesis in eukaryotes
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:tad00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    TRIADDRAFT_6279
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    TRIADDRAFT_6279
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 209 aa AA seqDB search
MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLSEQVPHYRQAQDMILDLEPDD
DLEDNPAQSEVIEQAAEVLYGLIHARYIMTNRGLAQMLEKYQQGDFGHCSRVYCENQPML
PVGLSDIPGESMLKLYCPKCQDVYTPKSSRYHHIDGAYFGTSFPHMLFMVHPEYRPKRSN
TQYVPRIFGFKIHPTAYQLQYQAAARSRS
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgagtagctcggaagaagtatcttggatatcttggttttgcggactacgtggtaatgaa
tttttttgcgaggtagatgaagactatattcaagataaatttaacttaactggtctaagt
gagcaagtccctcattacagacaagctcaggatatgatattagacttagaaccagatgat
gacctagaagataatcctgctcaaagtgaagtgattgaacaagctgctgaagtgctctat
ggcttaattcatgccagatatattatgacaaatcgcggtttagctcaaatgcttgaaaaa
tatcaacaaggtgattttggtcattgtagtcgtgtttattgtgagaatcagcccatgtta
cctgtgggattatcggatattcctggggaatcaatgttgaagttatactgccctaaatgc
caagacgtctacacaccgaaatcatcacgctatcatcatattgatggtgcttacttcggt
accagttttccccatatgctatttatggtacatccagaatatcgaccgaaacgaagcaat
acccaatatgtaccaaggatatttggattcaaaattcatccaactgcttatcagttacag
tatcaagcagcggcacgtagccgtagc

DBGET integrated database retrieval system