KEGG   Trichoplax adhaerens: TRIADDRAFT_6279Help
Entry
TRIADDRAFT_6279   CDS       T01069                                 

Definition
protein kinase Ck2-beta
Orthology
K03115  
casein kinase II subunit beta
Organism
tad  Trichoplax adhaerens
Pathway
Ribosome biogenesis in eukaryotes
Wnt signaling pathway
Class
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:tad03008]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:tad04310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 209 aa AA seqDB search
MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLSEQVPHYRQAQDMILDLEPDD
DLEDNPAQSEVIEQAAEVLYGLIHARYIMTNRGLAQMLEKYQQGDFGHCSRVYCENQPML
PVGLSDIPGESMLKLYCPKCQDVYTPKSSRYHHIDGAYFGTSFPHMLFMVHPEYRPKRSN
TQYVPRIFGFKIHPTAYQLQYQAAARSRS
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgagtagctcggaagaagtatcttggatatcttggttttgcggactacgtggtaatgaa
tttttttgcgaggtagatgaagactatattcaagataaatttaacttaactggtctaagt
gagcaagtccctcattacagacaagctcaggatatgatattagacttagaaccagatgat
gacctagaagataatcctgctcaaagtgaagtgattgaacaagctgctgaagtgctctat
ggcttaattcatgccagatatattatgacaaatcgcggtttagctcaaatgcttgaaaaa
tatcaacaaggtgattttggtcattgtagtcgtgtttattgtgagaatcagcccatgtta
cctgtgggattatcggatattcctggggaatcaatgttgaagttatactgccctaaatgc
caagacgtctacacaccgaaatcatcacgctatcatcatattgatggtgcttacttcggt
accagttttccccatatgctatttatggtacatccagaatatcgaccgaaacgaagcaat
acccaatatgtaccaaggatatttggattcaaaattcatccaactgcttatcagttacag
tatcaagcagcggcacgtagccgtagc

DBGET integrated database retrieval system