KEGG   Trichoplax adhaerens: TRIADDRAFT_63195Help
Entry
TRIADDRAFT_63195  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
tad  Trichoplax adhaerens
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    TRIADDRAFT_63195
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    TRIADDRAFT_63195
Enzymes [BR:tad01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     TRIADDRAFT_63195
Lipid biosynthesis proteins [BR:tad01004]
 Desaturase
  First
   TRIADDRAFT_63195
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 320 aa AA seqDB search
MPPQVPLTSLITEVEDKSEQVEEKKIAYKRQIIWRSVVRISILHILAFKGACLVPYAQTW
TLLWALSLYILGALGVTAGAHRLWTHRTYRATIPLRIFLMICNSVGLQDSILHWSRDHRV
HHKYSETDADPHNSKRGFFFSHIGWLMVRKHPEVLAKGKNINLQDLYNDRIVMFQHRYYR
LTLFLFWLLIPMMVPVLLWNESYSNSFFVAVVFRYTALLHATWSVNSFAHLWGMRPYDRY
IQPVENWAVSFAAIGEGFHNYHHTFPHDYSASEFRFLNFTTLFIDACAWLGLASNRRKVS
AEAIKRRINRTGKSSIQFDY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgccaccgcaagtaccgttgacctccctaatcactgaagttgaagataaaagtgagcaa
gtagaagagaaaaaaattgcgtacaaacgtcaaattatttggagaagcgttgtcaggata
tcaatactacatatcttagcttttaaaggagcatgtctcgttccttatgctcagacatgg
acattgctttgggcgctgtcgctatatatactcggagcgcttggtgtaactgctggagct
caccgcctgtggacccataggacttatagggcgacgattccattacgtatttttctcatg
atttgtaattctgtaggccttcaagatagcattttacattggagcagagatcacagagtt
catcataaatattctgagacagatgctgaccctcataactctaagcgaggattctttttc
agtcatattggttggttgatggtaaggaagcatccggaggttttggcgaaaggaaaaaat
atcaatttacaagatttgtataatgatagaattgtcatgtttcagcacaggtactatcgt
ttgactctctttctcttttggttattgataccaatgatggtgccggtgctactatggaat
gaaagttatagcaattccttttttgtagctgttgtttttcgctatacggctcttctccat
gctacatggtccgttaatagctttgcccacctttggggaatgcgaccttacgatcgttat
atccagcctgtcgaaaattgggctgtttcttttgcagcaattggtgaaggttttcataac
taccatcatacatttccgcatgactattctgctagcgaatttcgatttttaaactttaca
acattatttattgatgcatgtgcttggcttggtctagctagtaataggcgtaaagtatcc
gcagaagcgattaagagaaggattaataggaccggaaaatctagtatacagtttgattat
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system