KEGG   Trichoplax adhaerens: TRIADDRAFT_63333Help
Entry
TRIADDRAFT_63333  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
tad  Trichoplax adhaerens
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    TRIADDRAFT_63333
Enzymes [BR:tad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     TRIADDRAFT_63333
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 210 aa AA seqDB search
MVAPFVINATAKQTATVIFLHGLGDTGAGWCSAFQEICRPYIKYIFPNAPESPVTLNGGA
VMPSWFDLISLSLSGPEDEKGIKASTNHVRDLISAELNNDIASNRIIIGGFSQGGAIALN
TALTYEKKLGGIIGLSTFLEINVNKDCPIFQGHGDCDPLVNLRFGLMTKQILSSFNPNVN
FVTYPGMMHSSCPQEMEDVKKFIDERLPNQ
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggtggccccttttgttattaatgctactgcaaagcagaccgctaccgtgattttcctg
catggtcttggcgatactggagcaggatggtgcagcgctttccaagaaatctgtcgccct
tacatcaaatatattttccctaatgcaccagaatccccagtgactctcaacggtggagca
gtcatgccatcttggttcgatctaataagcctttcacttagtggacctgaagatgaaaaa
ggaattaaagcatccactaatcacgtacgagatttgatctctgctgaattaaacaatgat
atagctagcaatcgaataatcataggtggtttttcacaaggcggtgcaattgcgcttaac
accgctctgacctatgaaaaaaaactaggtggcattataggactgagtacatttctggaa
ataaatgtaaataaggattgtccaatatttcaaggccatggcgattgcgatcctctagta
aaccttcgattcggattaatgaccaagcaaatactatcatctttcaatccgaatgtgaat
tttgttacatatccaggaatgatgcacagctcatgtcctcaggaaatggaagatgtcaag
aaatttattgatgaacgattgccaaatcaataa

DBGET integrated database retrieval system