KEGG   Trichoplax adhaerens: TRIADDRAFT_63801Help
Entry
TRIADDRAFT_63801  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K07514  
enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase / 3,2-trans-enoyl-CoA isomerase [EC:4.2.1.17 1.1.1.35 5.3.3.8]
Organism
tad  Trichoplax adhaerens
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Peroxisome
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TRIADDRAFT_63801
   01212 Fatty acid metabolism
    TRIADDRAFT_63801
  Carbohydrate metabolism
   00640 Propanoate metabolism
    TRIADDRAFT_63801
   00650 Butanoate metabolism
    TRIADDRAFT_63801
  Lipid metabolism
   00071 Fatty acid degradation
    TRIADDRAFT_63801
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TRIADDRAFT_63801
   00310 Lysine degradation
    TRIADDRAFT_63801
   00380 Tryptophan metabolism
    TRIADDRAFT_63801
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TRIADDRAFT_63801
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    TRIADDRAFT_63801
Enzymes [BR:tad01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     TRIADDRAFT_63801
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     TRIADDRAFT_63801
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     TRIADDRAFT_63801
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 689 aa AA seqDB search
MTYSAFQRADSTHLAFEKAFLLNTVDTKCEQDRRIRVIILIGKGATFPAGADITEFPKLV
AGLMKDKTPTGLLCNGLDKISKPIVAAMHGTALGGGLELAMGCHYRIATRSTRVGLPEVA
LGILPGGSGTQRLPRLVGAEMAMDLISSGRHITALEGFRIGVIDKIVDEPLLDSAIDFAK
AIADKPVADRMECIKCVSYSVLPYEEGMKKEEQSMKVLMASYQARALQYSFFAQRSAPKW
SLSGVNSKNVKPIPVKTVGIIGAGTMGTGIAIALMTSKYRVVLLEVKKEYLDRGMKMIQS
TLERNVKRGRMTKQQAKACSALVKPTLAYKDLSDVDFVIEAVFEALEIKKEVFRKLVKHC
KVDIDANKFLQSNAILCSNTSYLDIDKIASVVPSPDKVMGMHFFAPANIMKLVECIKGTK
TSAETIATVMNLSLRMKKIPVLVGNCDGFVANRMLAPYAKEATFMVEEGALPHQIDDTLY
DYGMPMGPLRVGDLSGLDIGYRDRVGKGLTGPNAPKFENPLLRQGQRYSLLGDILHDTGR
LGQKTGKGWYKYEKGKAVVDPLVTEMIEKYCNEYGFSRRNITNAEIVERCFLSAANEGFK
ILEEGIALKPSDIDVIWQFGFGFPRHKGGPMFYVSNMIGLEKAYEKIQTYWEKHRDCRYW
QPSNLLKQLVANKADISQFQKFLPVSSRL
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgacttactcggcctttcaacgggcagactctacacatttggcattcgagaaagctttt
cttttaaatactgtagatacgaaatgcgagcaggatcgccgtattcgagtgataatatta
attggtaagggtgcgacatttccggccggtgcagacatcacagagtttccaaaacttgtt
gcaggtctaatgaaggacaagactcctacaggacttctttgcaatggtttagataaaatc
agcaaaccgattgtggctgctatgcatggtacggcactgggaggcggcttagaacttgca
atgggatgtcactacaggattgctacgcgatctaccagagttggtcttcctgaagttgct
ctgggcattctgcctggtggttcaggaacccagcgattaccacgtctagttggtgctgaa
atggcgatggatttgatatcgtctggaaggcacattactgcgctagagggattccgaatt
ggtgtaattgataagattgtagatgaaccgctattagatagcgcgatcgatttcgcaaaa
gccattgctgacaaaccagttgcagatcggatggagtgtattaaatgtgtttcttattct
gttctgccttatgaagaaggcatgaaaaaagaagaacaatcaatgaaagtactgatggcc
agctatcaagctcgagcattacagtactccttctttgcacagaggagtgcgccaaagtgg
tctttatcaggagtcaactccaaaaatgtcaagcctattccagtaaaaactgtagggatt
attggcgctggcactatgggcacgggtattgcgatcgcgttgatgacctcaaagtaccga
gttgtacttttggaagttaagaaagaatatttggatagaggaatgaaaatgatccaatca
acgcttgaaagaaacgtaaaacgtggccgaatgactaagcaacaggctaaagcatgctcc
gccttagtaaaaccaacgttggcatataaagatttgagtgacgttgattttgttatcgaa
gcagtctttgaagctttggaaattaagaaagaggtctttcgtaagcttgttaaacactgc
aaggtggatattgatgcgaacaaatttttacagagtaatgcaatattgtgctccaatacc
tcgtatttagacattgataagattgcttctgtggtgccgtctcccgataaagtgatgggc
atgcatttcttcgcaccagctaatatcatgaagctcgtagaatgtattaagggtacaaaa
acgtcagcggaaactattgcgaccgtcatgaatttgtcccttcgcatgaaaaagataccg
gtccttgttggcaactgtgatggatttgtagctaacagaatgctcgccccgtacgcaaag
gaggcaacatttatggtagaagaaggagcattacctcaccaaatcgatgacacattatat
gattatggaatgccaatgggaccattgagagttggagatttgtctggtttagatattggc
tacagagatcgagtcggcaaaggtctaactggtccaaatgctccaaaatttgagaatcct
ttgctaaggcaaggacaacgttattcccttttgggagacatattacatgacacagggaga
ttgggacagaagaccggaaagggatggtataaatacgagaaaggaaaagctgtagttgat
cctttagtaacagaaatgatcgaaaaatactgcaacgaatatggtttctcaagaaggaat
attacaaatgcggaaattgtggaacgttgttttctatctgctgccaatgaaggtttcaaa
atcttagaagaaggaattgcattgaaaccatccgatattgacgttatatggcaatttggt
ttcggatttcctcgtcataaaggaggaccgatgttttacgttagcaatatgataggctta
gaaaaggcttatgaaaaaatccagacttattgggaaaaacatagagattgtcgctattgg
caacccagcaacttactaaaacagctagtcgcaaataaagcagacatatcgcaatttcag
aaattcttgcctgtttcatcaagactatga

DBGET integrated database retrieval system