KEGG   Trichoplax adhaerens: TRIADDRAFT_63884Help
Entry
TRIADDRAFT_63884  CDS       T01069                                 

Definition
expressed hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
tad  Trichoplax adhaerens
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    TRIADDRAFT_63884
  Metabolism of other amino acids
   00480 Glutathione metabolism
    TRIADDRAFT_63884
Enzymes [BR:tad01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     TRIADDRAFT_63884
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 161 aa AA seqDB search
MTLSSLEKIDIRMNQLQAKYAHQGNGFAVLAFPCNQFGHQENLNGEEILHSLKHVRPGGG
YQPDCVVMDKCDVNGSNAHPLFQFLKESLPTPSDDADSLMSDPKFIIWKPVKRSDISWNF
EKFLITADGKPYKRYSRNFRTEAIANDIEHLLSVASKKGRK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgactttaagttctcttgaaaaaatagatatacgaatgaaccaattgcaagctaaatat
gctcatcaaggaaatggattcgctgttttagcttttccgtgcaatcagttcggccatcag
gaaaatttaaatggggaagaaattctccattcactcaagcatgttcgaccaggtggtgga
tatcaacctgattgtgtggttatggacaaatgtgacgtaaacggttctaatgctcatcca
ctatttcaattcttgaaagaatcgctacctactccaagcgatgatgcggatagtttaatg
agcgatccaaaatttattatatggaaacctgtcaaacgtagcgatatatcttggaatttt
gaaaaatttttgattacagcagatggcaaaccgtataagcgttacagtagaaattttcga
actgaagcaattgctaatgatattgaacatttacttagtgttgcttctaaaaaaggtcgt
aaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system