KEGG   Trichoplax adhaerens: TRIADDRAFT_814Help
Entry
TRIADDRAFT_814    CDS       T01069                                 

Definition
hypothetical protein
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
tad  Trichoplax adhaerens
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 350 aa AA seqDB search
LSLQDLTTVQIIFDVHLRYKPIECIGAGAYGVVCSAIDNRTGCRVAIKKIAKVFDNLILA
KRTYRELKILRHFKHDNIIAIREILLANQADGQDIYVIFDLMETDLHHIIHSQQPLTNDH
MQFFMYQLLRGLKYIHSANVLHRDLKPSNLLINSNCELKIGDFGMARCISSSQIDHTTYM
TEYVATRWYRAPELMLSLQGYTRAIDMWSVGCIFAEMLGRKQLFPGKTYVHQLRLIIGVL
GTPCHQFLLSSGAERVRKYIDSLPQRQRIAWTVLFPSITEHALTLLDQLLQFDPSQRLNV
EEALLHPYLASLHDAEDEPVCTSSFDFDFEKNTLSSNALKEVIVDEIKSF
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
ttatccttgcaagatttaacaacagtgcaaatcattttcgatgtccatttacgttataaa
cccattgaatgcattggcgccggtgcttatggagttgtctgctcggctatcgataatcgt
accggttgtcgtgttgctatcaagaaaatcgctaaagtatttgataacttgatcttggcc
aagagaacatatcgtgaattgaaaattttacgccatttcaaacatgataatattatcgca
atacgtgaaatcttattagctaatcaagctgacggacaagatatttacgtcatttttgat
ttaatggaaaccgatttacatcatattattcattcgcagcaacccttaaccaatgatcat
atgcaatttttcatgtatcaattattacgcggtctgaaatatatccattcagccaatgta
ttgcatcgcgatttaaaacccagtaacttattaattaatagtaattgcgagttgaaaatt
ggcgattttggtatggcacgttgtatttcttccagtcaaattgatcatacaacttatatg
acagaatatgttgcaacgcgatggtatcgtgcacctgaattaatgctaagcttacaaggt
tatacgcgtgctattgatatgtggtctgttggttgtatatttgctgaaatgttaggtagg
aaacaactcttccctggtaaaacttacgtacatcagttgcgtttgataataggtgtcttg
ggtacaccatgccatcaattcttgttatcatcaggtgctgaacgcgtacgcaagtatatt
gatagtttgccacaacgacagcgtattgcatggacagtgttgttcccatccataacagag
cacgctttaactttactcgatcagttgttacagtttgatcctagtcaaagactgaatgtg
gaagaagcattacttcatccttatttagcatcattacatgatgctgaagatgagcctgtt
tgtacgtccagttttgatttcgattttgaaaaaaacacattatcttccaatgccttgaaa
gaggtcattgtagatgaaattaaatctttt

DBGET integrated database retrieval system