KEGG   Trichoplax adhaerens: TRIADDRAFT_814Help
Entry
TRIADDRAFT_814    CDS       T01069                                 

Definition
hypothetical protein
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
tad  Trichoplax adhaerens
Brite
Enzymes [BR:tad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     TRIADDRAFT_814
Protein kinases [BR:tad01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   TRIADDRAFT_814
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 350 aa AA seqDB search
LSLQDLTTVQIIFDVHLRYKPIECIGAGAYGVVCSAIDNRTGCRVAIKKIAKVFDNLILA
KRTYRELKILRHFKHDNIIAIREILLANQADGQDIYVIFDLMETDLHHIIHSQQPLTNDH
MQFFMYQLLRGLKYIHSANVLHRDLKPSNLLINSNCELKIGDFGMARCISSSQIDHTTYM
TEYVATRWYRAPELMLSLQGYTRAIDMWSVGCIFAEMLGRKQLFPGKTYVHQLRLIIGVL
GTPCHQFLLSSGAERVRKYIDSLPQRQRIAWTVLFPSITEHALTLLDQLLQFDPSQRLNV
EEALLHPYLASLHDAEDEPVCTSSFDFDFEKNTLSSNALKEVIVDEIKSF
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
ttatccttgcaagatttaacaacagtgcaaatcattttcgatgtccatttacgttataaa
cccattgaatgcattggcgccggtgcttatggagttgtctgctcggctatcgataatcgt
accggttgtcgtgttgctatcaagaaaatcgctaaagtatttgataacttgatcttggcc
aagagaacatatcgtgaattgaaaattttacgccatttcaaacatgataatattatcgca
atacgtgaaatcttattagctaatcaagctgacggacaagatatttacgtcatttttgat
ttaatggaaaccgatttacatcatattattcattcgcagcaacccttaaccaatgatcat
atgcaatttttcatgtatcaattattacgcggtctgaaatatatccattcagccaatgta
ttgcatcgcgatttaaaacccagtaacttattaattaatagtaattgcgagttgaaaatt
ggcgattttggtatggcacgttgtatttcttccagtcaaattgatcatacaacttatatg
acagaatatgttgcaacgcgatggtatcgtgcacctgaattaatgctaagcttacaaggt
tatacgcgtgctattgatatgtggtctgttggttgtatatttgctgaaatgttaggtagg
aaacaactcttccctggtaaaacttacgtacatcagttgcgtttgataataggtgtcttg
ggtacaccatgccatcaattcttgttatcatcaggtgctgaacgcgtacgcaagtatatt
gatagtttgccacaacgacagcgtattgcatggacagtgttgttcccatccataacagag
cacgctttaactttactcgatcagttgttacagtttgatcctagtcaaagactgaatgtg
gaagaagcattacttcatccttatttagcatcattacatgatgctgaagatgagcctgtt
tgtacgtccagttttgatttcgattttgaaaaaaacacattatcttccaatgccttgaaa
gaggtcattgtagatgaaattaaatctttt

DBGET integrated database retrieval system