KEGG   Trichoplax adhaerens: TRIADDRAFT_9015Help
Entry
TRIADDRAFT_9015   CDS       T01069                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
tad  Trichoplax adhaerens
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:tad00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:tad00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 76 aa AA seqDB search
PKSNAEIKEFAEKNFNAEFQLFSKIKVNGSEALPLYKYLKSRLPGTLGNFIKWNFSKFLC
NKEGVPVQRYSPRTAP
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
cctaagtctaacgcagaaataaaagaatttgcagaaaaaaatttcaacgctgaattccag
ctcttcagtaaaattaaagtcaatggatcagaggctctccctctgtataaatatttgaaa
tctcgtttaccagggacattaggaaattttattaaatggaattttagtaaatttctctgc
aataaagagggcgtaccggttcaacgatactcaccaagaactgcgcca

DBGET integrated database retrieval system