KEGG   Trichoplax adhaerens: TRIADDRAFT_9015Help
Entry
TRIADDRAFT_9015   CDS       T01069                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
tad  Trichoplax adhaerens
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    TRIADDRAFT_9015
  Metabolism of other amino acids
   00480 Glutathione metabolism
    TRIADDRAFT_9015
Enzymes [BR:tad01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     TRIADDRAFT_9015
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 76 aa AA seqDB search
PKSNAEIKEFAEKNFNAEFQLFSKIKVNGSEALPLYKYLKSRLPGTLGNFIKWNFSKFLC
NKEGVPVQRYSPRTAP
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
cctaagtctaacgcagaaataaaagaatttgcagaaaaaaatttcaacgctgaattccag
ctcttcagtaaaattaaagtcaatggatcagaggctctccctctgtataaatatttgaaa
tctcgtttaccagggacattaggaaattttattaaatggaattttagtaaatttctctgc
aataaagagggcgtaccggttcaacgatactcaccaagaactgcgcca

DBGET integrated database retrieval system