KEGG   Tepidanaerobacter acetatoxydans Re1: TepiRe1_1830Help
Entry
TepiRe1_1830      CDS       T02434                                 

Definition
PTS system fructose subfamily IIA component
Orthology
K17464  
PTS system, D-glucosaminate-specific IIA component [EC:2.7.1.69]
Organism
tae  Tepidanaerobacter acetatoxydans Re1
Pathway
Pentose phosphate pathway
Microbial metabolism in diverse environments
Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:tae00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TepiRe1_1830
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    TepiRe1_1830
Enzymes [BR:tae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.69  protein-Npi-phosphohistidine---sugar phosphotransferase
     TepiRe1_1830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1755088..1755546)
Genome map
AA seq 152 aa AA seqDB search
MKSFKRGCEFILEKENLPYIILLTHGNWGQELIKSAEMICGTLKNVYAFPLQPAQSTNDY
MVNIESVVKTAPKGSIIIADLFRGTTSNIAAAISAKYDVIALSGLNIAMLIEANEYRTKY
KGEELSEKLIEKATENCKNIGKILRESKYLMK
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatcttttaagagaggatgtgagtttattttagaaaaagaaaatttgccatatatt
attttacttacgcacggtaattggggtcaagaattaattaagagtgcagaaatgatatgt
ggcactttaaaaaatgtttatgcgtttccattacagccagctcaatcgactaatgactat
atggttaatattgaatcagtcgtgaagactgcaccaaaaggcagtatcataatcgctgat
ttatttcgaggtactacatctaatatagcagcagcaatttcagccaaatatgatgtaata
gctttatcgggtttaaatattgcgatgcttattgaggccaatgagtataggacaaaatat
aaaggtgaagagttatcagaaaagctaatagaaaaggcaactgaaaattgtaagaatata
ggtaaaatattacgagaatctaagtatctcatgaaataa

DBGET integrated database retrieval system