KEGG   Tepidanaerobacter acetatoxydans Re1: TepiRe1_2800Help
Entry
TepiRe1_2800      CDS       T02434                                 

Definition
Polar amino acid ABC transporter, inner membrane subunit
Orthology
K02029  
polar amino acid transport system permease protein
Organism
tae  Tepidanaerobacter acetatoxydans Re1
Module
Putative polar amino acid transport system
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2718171..2718725)
Genome map
AA seq 184 aa AA seqDB search
MFEYILRLLPALLSGLEVTLKVFFLTLVISIPLGILVALGRLSKIKPLVFLVELYIWVMR
GTPLLLQIVVIFFGLPIVGITFDRFPAAILAFVLNYAAYFGEIFRGGIESIDKGQYDAAK
VLGFTPVKTFTRIILPQMIKIVLPSVANEVITLVKDTSLVYVVGLGELLRAGKIASNRDA
PWCR
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaatatattttaagactattgcctgctttgctatcagggcttgaggtaacctta
aaagtgtttttcttaacgcttgtaatatctatacctttaggaatccttgtagccctaggc
aggctgtcaaaaattaagccactggtatttttggtggagctttatatttgggtcatgcga
ggaacgccgctgctgctgcaaatagtagttatattttttggattacccattgtgggaata
acctttgacaggtttcctgctgccatactggcgtttgtgctaaattatgcggcgtatttc
ggagaaatcttcagaggcggcattgaatctatcgataaaggtcaatacgatgcggcaaag
gtgctgggttttactcctgtaaagacctttacaagaattatcctgccgcaaatgataaag
atagtgctgccgtcagtggccaatgaggtaataacccttgtaaaagatacatcactggtg
tacgtagtgggcctgggagagcttttgcgggcagggaaaatagcatccaatcgcgatgct
ccctggtgccgctga

DBGET integrated database retrieval system